KEGG   Ailuropoda melanoleuca (giant panda): 100465592Help
Entry
100465592         CDS       T01329                                 

Definition
eukaryotic translation initiation factor 4E-like
Orthology
K03259  
translation initiation factor 4E
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100465592
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100465592
   04151 PI3K-Akt signaling pathway
    100465592
   04150 mTOR signaling pathway
    100465592
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100465592
Translation factors [BR:aml03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100465592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 217 aa AA seqDB search
MATVEPETTPTPNPPPTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctactcctaatcccccgcctacagaagaagag
aaaacagaatctaatcaggaggttgctaacccagaacactatattaaacatcctttacag
aacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cggctgatctctaagtttgatactgttgaagacttttgggctctgtacaaccacatccag
ttgtctagtaacttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgagaaaaacaaacgaggaggacgatggctaattacattgaacaagcag
cagagacgaagtgacctggatcgcttttggctagagacactgctgtgccttattggagaa
tcttttgatgactacagtgatgatgtatgtggagctgttgttaatgttagagctaaaggt
gataagatagcaatatggactactgaatgtgaaaacagagaggctgttacacatataggg
agggtatacaaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccat
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system