KEGG   Ailuropoda melanoleuca (giant panda): 100465592Help
Entry
100465592         CDS       T01329                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml03013  RNA transport
aml04066  HIF-1 signaling pathway
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04211  Longevity regulating pathway
aml04910  Insulin signaling pathway
Module
aml_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100465592 (EIF4E)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100465592 (EIF4E)
   04151 PI3K-Akt signaling pathway
    100465592 (EIF4E)
   04150 mTOR signaling pathway
    100465592 (EIF4E)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100465592 (EIF4E)
  Aging
   04211 Longevity regulating pathway - mammal
    100465592 (EIF4E)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100465592 (EIF4E)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100465592 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100465592 (EIF4E)
Translation factors [BR:aml03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100465592 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100465592
NCBI-ProteinID: XP_002921244
Ensembl: ENSAMEG00000013873
Position
Un
AA seq 217 aa AA seqDB search
MATVEPETTPTPNPPPTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctactcctaatcccccgcctacagaagaagag
aaaacagaatctaatcaggaggttgctaacccagaacactatattaaacatcctttacag
aacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cggctgatctctaagtttgatactgttgaagacttttgggctctgtacaaccacatccag
ttgtctagtaacttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgagaaaaacaaacgaggaggacgatggctaattacattgaacaagcag
cagagacgaagtgacctggatcgcttttggctagagacactgctgtgccttattggagaa
tcttttgatgactacagtgatgatgtatgtggagctgttgttaatgttagagctaaaggt
gataagatagcaatatggactactgaatgtgaaaacagagaggctgttacacatataggg
agggtatacaaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccat
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system