KEGG   Ailuropoda melanoleuca (giant panda): 100465803Help
Entry
100465803         CDS       T01329                                 

Gene name
BDH2
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase, type 2
  KO
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100465803 (BDH2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100465803 (BDH2)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100465803 (BDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 126 aa AA seqDB search
MLAQKSGNIINMSSVASSVKGVLNRCVYSATKAAVIGLTKSMAADFIQQGIRCNCVCPGT
VDTPSLQGRIQARPNPEEGQACLLKRQKTGRFATAEEIALLCVYLASDESAYMTGNPVII
DGGWSL
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcacagaaatctggcaacattatcaacatgtcgtctgtggcttccagcgtcaaa
ggagttctgaacagatgtgtgtacagtgcaaccaaggcggcagtgattggcctcacaaag
tccatggctgcagatttcatccagcaggggatcaggtgcaactgcgtgtgtccaggaaca
gttgataccccatctctgcaaggaagaatacaagccagaccaaatcccgaagagggacag
gcctgtttgctgaagagacagaagactggaagatttgctactgcagaagaaatagccctg
ctgtgtgtgtatttggcttctgatgaatctgcctacatgacaggcaatcctgtcatcatt
gatggaggctggagcttgtga

DBGET integrated database retrieval system