KEGG   Ailuropoda melanoleuca (giant panda): 100465876Help
Entry
100465876         CDS       T01329                                 

Gene name
CES5A
Definition
(RefSeq) carboxylesterase 5A
  KO
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100465876 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 428 aa AA seqDB search
MLSDQHFLKVHYPKLEVSEDCLYLNIYAPAHADSGSKLPVMVWLPGGAFETGSASIFDGS
ALAAYEDVLIVTTQYRLGIFGFFNTGDQHAWGNWAFLDQMAALTWVQENIEFFGGDPRSV
TLFGESAGAISVSSLILSPMAKGLFHKAIMESGVAIIPFLRAPDDERDEDLQVIAHICGC
NASDTMALLQCLRAKSAEELLDINKKTKSFTRVVDGFFFPDEPLDLLTEKTFNSVPSVIG
VNNHECGFQLPKKEFPEILGGSKKSLALHLLQTVLHIPNKYLYLVADQYFSNKHSLVEIR
DSFLDLLGDVFFVVPGVVTARYHRDAGAPVYFYEFQHAPQCLKDTRPAFVKADHSDEIRF
VFGGAFLKGDVVMFEGATEEEKLLSRKMMRYWANFARTGDPNGEGLPLWPAYSRSELYLK
LDLNGIHR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgctctcagatcaacactttctcaaggtgcattaccccaagttggaagtgtccgaagat
tgcctgtaccttaacatctatgcgccagcccatgcggacagcggctccaagctccccgtc
atggtgtggctccccgggggcgcctttgagacaggctctgcgtccatcttcgatgggtct
gccctagctgcctatgaggacgtgctgattgtgacgacccagtaccgcctaggaatattt
ggtttcttcaacacaggggaccagcatgcttgggggaactgggccttcctggaccagatg
gccgccttaacctgggtccaggagaacatcgagttcttcggtggggacccacgctctgtg
accctctttggcgagtcagcgggagccataagtgtttccagccttattctgtcccccatg
gccaaaggcttattccacaaagccatcatggagagtggggtggccatcatccctttcctg
agggcccctgatgatgagagggatgaagatttgcaggtgatcgcgcatatctgtggttgc
aatgcgtcagacaccatggccttgctgcagtgcctgagggcgaaatccgccgaggagttg
ttggacatcaacaagaaaaccaagtctttcactcgagtggttgatggttttttctttcct
gatgagcctctagaccttttgactgaaaaaacatttaattccgttccttctgtcatcgga
gtcaataaccacgaatgtggcttccagctacccaagaaggagtttcctgagatccttggg
ggctccaaaaagtctctagccctgcacttgctacaaacagtcctgcacatccccaacaag
tatttataccttgtggctgatcaatacttctccaacaagcactccctggttgagatacga
gatagttttctggacttgcttggagatgtgttctttgtggtccctggggtggtcacagct
cgatatcacagagatgctggcgcacctgtctacttctacgagtttcaacacgcgccccag
tgcttaaaggacacaaggccagctttcgtcaaagccgatcactctgatgaaatccgcttt
gtctttggaggtgccttcctgaaaggcgacgttgtcatgttcgaaggagccaccgaggag
gagaaattgctgagcaggaagatgatgaggtactgggccaacttcgctaggactggggac
cctaacggggaaggcctgcctctgtggccggcctacagccggagcgagctgtacctgaag
ctggatttgaatggtattcatcgctag

DBGET integrated database retrieval system