KEGG   Ailuropoda melanoleuca (giant panda): 100465899Help
Entry
100465899         CDS       T01329                                 

Definition
histone acetyltransferase KAT5-like
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
HTLV-I infection
Class
Human Diseases; Infectious diseases; HTLV-I infection [PATH:aml05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 513 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctgcccgtgcttcggcggaaccag
gacaacgaagatgagtggcccctggccgagatcctgagcgtgaaggacatcagtggccgc
aagcttttctacgtccattacattgacttcaacaaacgcctggatgaatgggtgacccac
gagcggctggacctaaagaagattcagttccccaagaaagaggccaagacccccaccaag
aacggacttcctgggtctcgccccggctctccagagagagaggtgccggcctccgcccag
gccagcgggaagaccttgccaatcccggtccagatcacactccgcttcaacctgcccaag
gagcgggaggccattcccggtggcgagcctgaccagccgctctcctccagctcctgcctg
cagcccaaccaccgctcaacgaaacgcaaggtggaggtggtttcaccagcaactccagtg
cccagcgagacagccccagcctcagtttttccccagaatggatcagcccgtagggcagtg
gcagctcagccaggacggaagcgaaaatcaaattgcttgggcactgacgaggactcccag
gacagctcagatggaataccgtcagcgccacgcatgactggcagcttggtgtctgaccgg
agccacgacgacattgtcacccggatgaagaacatcgagtgcatcgagctgggccggcac
cgcctgaagccgtggtacttctccccgtacccacaggagctcaccacgttgcctgtcctc
tacctctgcgagttctgcctcaaatatggccggagcctcaagtgtctgcagcgtcacttg
accaagtgtgacctgcgacatcctccgggcaatgagatttaccgcaaaggcaccatctct
ttctttgagattgacggacgtaagaataagagttattcccagaacctgtgtctcttggcc
aagtgttttctcgaccacaagacattgtactatgacacagaccccttcctcttctatgtc
atgacagagtatgactgcaagggcttccacatcgtgggctacttctccaaggagaaggaa
tcgacagaagactacaacgtggcctgcatcctgaccctgcctccctaccagcgccgcggc
tacggcaagctgctgatcgagttcagctatgaactctccaaagtggaagggaaaacgggg
acccctgagaagcccctctcagaccttggcctcctatcctaccggagctactggtcccag
accatcctggagatcctgatggggctgaagtcagagagcggggagaggccacagatcacg
atcaacgagatcagtgaaatcaccagcatcaagaaggaggatgtcatttccaccctgcag
tacctcaacctcatcaactactacaagggccagtacatcctcacgctgtcagaggacatc
gtggacggacacgagagagctatgctcaagcggctccttcggatcgactccaagtgtctg
cacttcactcccaaggactggagcaagaggggaaagtggtga

DBGET integrated database retrieval system