KEGG   Ailuropoda melanoleuca (giant panda): 100465925Help
Entry
100465925         CDS       T01329                                 

Definition
protein disulfide-isomerase A4-like
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100465925
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100465925
Enzymes [BR:aml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100465925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 643 aa AA seqDB search
MRLRKACLLLLLLALAQLLAAASAGGPDEDSSNKEDAIEEEEEEDDDDDDEDDLEVKEEN
GVLVLNDVNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASALKENDPPIPVAKIDA
TSESALASRFDVSGYPTIKVLKKGQAVDYEGSRTQEEIVAKVREISQPNWTPPPEVTLVL
TKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETD
LAKRFDVSGYPTLKIFRKGKPFDYNGPREKYGIVDYMIEQSGPPSKEVVALKQVQEFLKD
GDDVIIIGVFKAESDPAYQQYQDAANNLREDYKFHHTFNTEIAKFLKVSPGKLVVMQPEK
FQSKYEPRSHVMDIESSTEGAAIKDHVLKYTLPLVGHRKTSNDAKRYTRRPLVVVYYSVD
FSFDYRAATQFWRNKVLEVAKDFPEYTFAVADEEDFATEVKDLGLSESGEDVNAAILDEG
GRKFAMEPDDFDSDALREFVRAFKKGKLKPVVKSQPVPKNNKGPVKVVVGKTFDSIVMDP
KKDVLIEFYAPWCGHCKQLEPEYTALGKKYKNHKNLVIAKMDATANDITNDRYKVEGFPT
IYFAPSGDKKNPIKFEDGNRDLEHLSKFVEEHATKLSRTREDL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccggaaagcatgcctgctgcttctgctcctggcgctggcgcagctactggcc
gcagcgagcgccggggggccggacgaagattcttctaataaagaagatgccattgaggag
gaggaggaggaggacgacgacgacgatgacgaggatgacttggaagtcaaggaagaaaat
ggtgtcctggtcctgaatgacgtgaactttgataacttcgtggctgacaaagacacggtg
ctgctggagttctatgctccatggtgtggacattgcaagcagtttgctccagaatatgaa
aaaatcgccagtgccttgaaggagaacgaccctcccattcctgtggccaagatcgacgca
acgtcagagtcggcactggccagcaggtttgatgtgagcggctaccccaccatcaaggtc
cttaagaaggggcaggctgtggactacgagggctccaggactcaggaagaaatcgttgcc
aaggtcagagagatctcccagcccaactggacgcctccaccagaagtcacgcttgtgctg
accaaagagaacttcgatgaagtggtgaatgacgcagacatcattctggtggagttctat
gccccgtggtgtggacactgcaagaagctggcccccgagtacgagaaggccgccaaggag
ctgagcaagcgctcccccccaatccccctggccaaggtcgacgccactgcggagacagac
ctggccaagaggttcgatgtctctggctatcccaccctgaaaatcttccgcaagggaaag
ccttttgattacaacggcccacgggaaaaatatggtatcgtggactacatgatcgagcag
tccgggccaccctccaaggaggtcgtggctctgaagcaggtccaggagttcctgaaggat
ggggatgacgtcatcatcattggggtctttaaagcagagagtgacccagcctaccagcag
taccaggatgctgcgaacaacctgagagaagattataaattccaccacactttcaacact
gaaatagcaaagttcttgaaagtctccccggggaagctggtcgtaatgcagcctgagaag
ttccagtccaagtacgagccgcggagccacgtcatggacattgagagctccacggagggg
gcagccatcaaggaccacgtgttgaagtacacgttgcctctggtgggtcaccgcaagacc
tccaacgacgccaagcggtacacgcggcgccctctggtggtcgtctactacagcgtggac
ttcagcttcgattacagagctgccactcagttttggcggaacaaagtcctggaggtggcc
aaggacttccccgagtacacctttgccgtggctgacgaggaggacttcgccacggaggtg
aaggacctggggctcagtgagagcggggaggacgtcaacgcagccatcctggacgagggc
gggcggaagttcgccatggagcctgacgactttgactctgacgctctccgggagtttgtc
agagctttcaaaaaaggaaaactgaagccagtcgtcaaatcccagccggtgcccaagaac
aacaaggggcctgtcaaggtcgtggtggggaagacctttgactccattgtgatggacccc
aagaaggatgtcctcatcgaattctacgcaccctggtgcgggcactgcaagcagctggag
cccgagtacaccgccctcggcaagaagtacaagaaccacaagaatctggtcatcgccaag
atggacgccactgccaacgacatcaccaacgaccgctacaaagttgaggggttccctacc
atctacttcgcccccagtggggacaaaaagaacccaattaaatttgaggacggaaacaga
gatctggaacatttgagcaagtttgtggaagaacatgccacaaaactgagcaggaccagg
gaagacctttga

DBGET integrated database retrieval system