KEGG   Ailuropoda melanoleuca (giant panda): 100465937Help
Entry
100465937         CDS       T01329                                 

Definition
protein O-mannosyl-transferase 2-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100465937
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100465937
Glycosyltransferases [BR:aml01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100465937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 730 aa AA seqDB search
SGLRSRRGRCGHQVTRAVGPDVAAEAAARSPKRXAGRWALLALVTLLSFATRFHRLDEPP
HICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFLFQKPGDKYEHHN
YMGMRGFCAFLGSLLVPFAYLIVLELSKSLPAALLTAALLTFDTGCLTLSQYILLDPILM
FFIMAAMLSMVKYNSCADRPFSAPWWFWLSLTGINLAGALGVKFVGLFIILQVGWNTISD
LWHLFGDLSLSVVTVGKHLTARILCLIVLPLTLYTATYAVHFMVLNKSGPGDGFFSSAFQ
ARLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRHLYPEGIGARQQQVTTYLHKD
YNNLWIIKKHNTNADPLDPSFPAEFVRHGDIIRLEHKETSRNLHSHYHEAPLTRKHYQVT
GYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRLIHLVTGCVLGSSGKVLPKWGWEQL
EVTCTPYLKETLNSIWNVEDHINPKLPNISLDVLQPTFPEILLESHMVMIRGNNGLKPKD
NEFTSKPWHWPINYQGLRFSGINDTDFRVYLLGNPVVWWLNLSSIVLYLLLGSIFAVAVQ
RGARLPAEVEGLSQVLLQGGGQLLLGWMLHYFPFFLMGRILYFHHYFPAMLFSSMLTGIL
WDTLLRLCAWSLASSSLARGVYVVGLLSLLLGTAYSFCLFHPLAYGMVGPLAQDPRSPMA
GLRWLESWDF
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
tcagggctgcgttcccggcggggccgctgtgggcaccaggttactagggctgtgggcccg
gacgtggccgccgaggctgcagcgcggagccccaaacggncagccggccggtgggccctg
ctggccctggtgacgttgctgtccttcgccacccgcttccaccgtctggacgagccgccg
cacatctgttgggatgagactcactttggaaaaatgggaagctattatatcaaccgcacc
tttttctttgatgtgcacccacctctgggaaagatgctgataggtcttgctggctacctg
agtgggtatgatgggacttttttgttccagaagcctggggacaaatatgagcatcacaac
tacatgggaatgagaggattctgtgctttccttggttccttgttggtcccctttgcctac
ctcattgtattggagctgtccaagtctctccccgcagcactgctcactgctgccctcctc
acctttgatacaggatgcctcactctgtcccagtatatcctccttgaccccatcttgatg
ttcttcatcatggctgccatgctgagcatggtcaagtacaactcctgtgccgacaggccc
ttctctgccccctggtggttctggctcagcctgactggcattaatctggctggtgcttta
ggggtcaagtttgttggcctctttatcatcctgcaagtggggtggaacaccatttcagac
ctttggcacctgtttggagacctcagtctttcagtggtgactgtggggaaacacctgacc
gctcgcatcctatgcctcatagtgctgccgctgactctctacacggccacgtatgctgtt
catttcatggtgctgaacaaaagtggtcctggcgatggcttcttcagttctgctttccag
gcccggctttcaggcaacaaccttcacaatgcttccatccccgaacatctggcctatggc
tctgtgatcaccgtgaagaacctgcggatggccatcggctatctccactcccacaggcac
ctctaccccgagggcattggtgcccgccagcagcaggttaccacctatttgcacaaagac
tacaacaacctgtggattatcaagaaacataacacaaacgcagatcccctggacccttcc
ttcccagcggagtttgtgagacatggagacatcattaggctagaacacaaagagacttct
cggaacctgcacagtcactatcacgaggcccccctgacccggaagcactatcaggtcact
ggctatggcataaacgggacaggggactcaaatgatttctggcggattgaggttgtaaac
agaaaatttggaaaccggatcaaagtgctaagaagtcgcattcgcctcatccatctggtc
acgggttgtgtcctgggctcctcgggaaaggtcttgcctaagtggggctgggaacagttg
gaagttacttgcaccccatatctaaaggaaaccctcaactctatctggaatgtggaggac
catatcaatcccaaattgccaaacatcagcctggatgtgctgcagcccacttttcctgag
atcttgctggagtcccacatggtgatgatccgggggaacaatggcctcaaacccaaggac
aatgagttcacatccaaaccctggcactggcctatcaactatcagggcctgcgcttctca
gggatcaatgatacagacttccgcgtgtatctgctcggcaacccggtggtttggtggctg
aatctgtcgagcattgtcctctacctcctcttggggagcatctttgctgtcgccgtgcag
agaggggcacgcctgcctgcggaggttgaagggctgtcccaggtcctgctgcaaggaggc
ggtcagctcctgctcggctggatgctgcattacttcccattcttcctgatgggccggatc
ctctacttccaccactacttcccggccatgctcttctccagcatgttgacagggattctg
tgggatactctcctgcggctctgtgcctggagtctggcctcctcttccctggccaggggc
gtatatgtggtgggactcttgagcctgctcctgggaactgcctatagcttctgcctcttc
caccctctggcttacgggatggtgggtcccctagcccaggacccccggagtcccatggcg
ggactaaggtggcttgaatcatgggacttttga

DBGET integrated database retrieval system