KEGG   Ailuropoda melanoleuca (giant panda): 100465937Help
Entry
100465937         CDS       T01329                                 

Definition
protein O-mannosyl-transferase 2-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:aml00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 730 aa AA seqDB search
SGLRSRRGRCGHQVTRAVGPDVAAEAAARSPKRXAGRWALLALVTLLSFATRFHRLDEPP
HICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFLFQKPGDKYEHHN
YMGMRGFCAFLGSLLVPFAYLIVLELSKSLPAALLTAALLTFDTGCLTLSQYILLDPILM
FFIMAAMLSMVKYNSCADRPFSAPWWFWLSLTGINLAGALGVKFVGLFIILQVGWNTISD
LWHLFGDLSLSVVTVGKHLTARILCLIVLPLTLYTATYAVHFMVLNKSGPGDGFFSSAFQ
ARLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRHLYPEGIGARQQQVTTYLHKD
YNNLWIIKKHNTNADPLDPSFPAEFVRHGDIIRLEHKETSRNLHSHYHEAPLTRKHYQVT
GYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRLIHLVTGCVLGSSGKVLPKWGWEQL
EVTCTPYLKETLNSIWNVEDHINPKLPNISLDVLQPTFPEILLESHMVMIRGNNGLKPKD
NEFTSKPWHWPINYQGLRFSGINDTDFRVYLLGNPVVWWLNLSSIVLYLLLGSIFAVAVQ
RGARLPAEVEGLSQVLLQGGGQLLLGWMLHYFPFFLMGRILYFHHYFPAMLFSSMLTGIL
WDTLLRLCAWSLASSSLARGVYVVGLLSLLLGTAYSFCLFHPLAYGMVGPLAQDPRSPMA
GLRWLESWDF
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
tcagggctgcgttcccggcggggccgctgtgggcaccaggttactagggctgtgggcccg
gacgtggccgccgaggctgcagcgcggagccccaaacggncagccggccggtgggccctg
ctggccctggtgacgttgctgtccttcgccacccgcttccaccgtctggacgagccgccg
cacatctgttgggatgagactcactttggaaaaatgggaagctattatatcaaccgcacc
tttttctttgatgtgcacccacctctgggaaagatgctgataggtcttgctggctacctg
agtgggtatgatgggacttttttgttccagaagcctggggacaaatatgagcatcacaac
tacatgggaatgagaggattctgtgctttccttggttccttgttggtcccctttgcctac
ctcattgtattggagctgtccaagtctctccccgcagcactgctcactgctgccctcctc
acctttgatacaggatgcctcactctgtcccagtatatcctccttgaccccatcttgatg
ttcttcatcatggctgccatgctgagcatggtcaagtacaactcctgtgccgacaggccc
ttctctgccccctggtggttctggctcagcctgactggcattaatctggctggtgcttta
ggggtcaagtttgttggcctctttatcatcctgcaagtggggtggaacaccatttcagac
ctttggcacctgtttggagacctcagtctttcagtggtgactgtggggaaacacctgacc
gctcgcatcctatgcctcatagtgctgccgctgactctctacacggccacgtatgctgtt
catttcatggtgctgaacaaaagtggtcctggcgatggcttcttcagttctgctttccag
gcccggctttcaggcaacaaccttcacaatgcttccatccccgaacatctggcctatggc
tctgtgatcaccgtgaagaacctgcggatggccatcggctatctccactcccacaggcac
ctctaccccgagggcattggtgcccgccagcagcaggttaccacctatttgcacaaagac
tacaacaacctgtggattatcaagaaacataacacaaacgcagatcccctggacccttcc
ttcccagcggagtttgtgagacatggagacatcattaggctagaacacaaagagacttct
cggaacctgcacagtcactatcacgaggcccccctgacccggaagcactatcaggtcact
ggctatggcataaacgggacaggggactcaaatgatttctggcggattgaggttgtaaac
agaaaatttggaaaccggatcaaagtgctaagaagtcgcattcgcctcatccatctggtc
acgggttgtgtcctgggctcctcgggaaaggtcttgcctaagtggggctgggaacagttg
gaagttacttgcaccccatatctaaaggaaaccctcaactctatctggaatgtggaggac
catatcaatcccaaattgccaaacatcagcctggatgtgctgcagcccacttttcctgag
atcttgctggagtcccacatggtgatgatccgggggaacaatggcctcaaacccaaggac
aatgagttcacatccaaaccctggcactggcctatcaactatcagggcctgcgcttctca
gggatcaatgatacagacttccgcgtgtatctgctcggcaacccggtggtttggtggctg
aatctgtcgagcattgtcctctacctcctcttggggagcatctttgctgtcgccgtgcag
agaggggcacgcctgcctgcggaggttgaagggctgtcccaggtcctgctgcaaggaggc
ggtcagctcctgctcggctggatgctgcattacttcccattcttcctgatgggccggatc
ctctacttccaccactacttcccggccatgctcttctccagcatgttgacagggattctg
tgggatactctcctgcggctctgtgcctggagtctggcctcctcttccctggccaggggc
gtatatgtggtgggactcttgagcctgctcctgggaactgcctatagcttctgcctcttc
caccctctggcttacgggatggtgggtcccctagcccaggacccccggagtcccatggcg
ggactaaggtggcttgaatcatgggacttttga

DBGET integrated database retrieval system