KEGG   Ailuropoda melanoleuca (giant panda): 100465955Help
Entry
100465955         CDS       T01329                                 

Definition
tropomyosin alpha-1 chain-like
Orthology
K10373  
tropomyosin 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100465955
   04261 Adrenergic signaling in cardiomyocytes
    100465955
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100465955
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100465955
   05414 Dilated cardiomyopathy (DCM)
    100465955
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100465955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRVSEDERDRV
LEELHKAEDSLLAADEAAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSESQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLELNNM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctcaagctcgacaaggagaacgccttggat
cgagccgagcaggcggaagccgataagaaggcggcggaggacaggagcaagcagctcgag
gaggacatcgcggcgaaggagaagctgctgcgggtgtcggaggacgagcgggaccgggtt
ctggaggagctgcacaaggcggaggacagcctcctggccgcggatgaggccgccgccaag
gctgaagccgacgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaagagcgactggcaacagctttgcagaagctggaggaggcggagaaggcagcg
gacgagagcgagagaggcatgaaagtcattgagagtcgagcccaaaaggatgaggagaaa
atggaaattcaggagatccaactgaaagaggccaagcatattgctgaagatgccgaccgc
aagtatgaagaggtggcccgtaagctggtcatcatcgagagtgacctggaacgcgcggag
gagcgggctgagctctcagaaagccaagttcgacagctggaagaacaattaagaataatg
gatcagaccttgaaagcattaatggctgcagaggataagtactcgcagaaggaagacaaa
tacgaggaggagatcaaggtcctctctgacaagctgaaggaggccgagactcgggctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagagaaagtg
gctcatgccaaagaagagaaccttagtatgcatcagatgctggatcagactttactggag
ttaaacaacatgtga

DBGET integrated database retrieval system