KEGG   Ailuropoda melanoleuca (giant panda): 100465984Help
Entry
100465984         CDS       T01329                                 

Gene name
HEXB
Definition
(RefSeq) hexosaminidase subunit beta
  KO
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo and isoglobo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100465984 (HEXB)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100465984 (HEXB)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100465984 (HEXB)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100465984 (HEXB)
   00511 Other glycan degradation
    100465984 (HEXB)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100465984 (HEXB)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100465984 (HEXB)
Chaperones and folding catalysts [BR:aml03110]
 Intramolecular chaperones
  Others
   100465984 (HEXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 556 aa AA seqDB search
MSQTVRAWTSLKKAEKQDPHSAQLWYLVRLWGRLGKREDKCPGCSSGRRGPSEQRGGHGA
PRAGAAGAAGGAGPVLLENFSIYHDPSSTAGPSCSLLQEAFRRYYDYIFDFNKSRLNPAK
HNSAAELKQLLVSVVLESECDLYPSITSDESYTLAVEGPVAFLKANRVWGVLRGLETFSQ
LIYQDSYGTFTVNESNIIDSPRFPHRGILIDTARHFLPIKTILKTLDAMAFNKFNVLHWH
IVDDQSFPYQSVAFPELSNKGSYSLSHVYTPNDVRTVIEYARLRGIRVIPEFDSPGHTQS
WGKGQKNLLTPCYNGPKQSGTFGPINPILNSTYCFLSQFFKEVSTMFPDQFVHLGGDEVE
FTCWESNPEVIAFMKKAGFGRDFQRLQSFYIQKLLGIVSTLNKGAIVWQEVFDDHAKLNP
GTVVQVWKNEMYHVTQAAVTAAGFPVILSAPWYLDWISYGQDWRNYYKVDPLDFDGSQEQ
KKLVIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSQQNIKDIEDAYDRLTIHRCRMT
RRGIAAEPLFTGYCNF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagacagtgagggcctggacttcactgaagaaagcagagaagcaggacccccac
agcgcgcagctgtggtacctggtgcgtttgtggggccgtctggggaagcgggaagacaag
tgtccaggctgcagctccggcagacgtgggccgagcgagcagcggggtggtcatggagca
ccgcgggctggggctgctggcgctgctggcggcgctggccccgtgctgctggagaacttc
tccatctaccacgacccctcgtccaccgccggcccctcctgctccctcctgcaagaagcg
ttccggcgatactatgactatatttttgatttcaacaagtcacggctcaaccctgctaaa
cataatagtgcagcggagttaaagcaacttctcgtctcagttgtccttgaatcggagtgt
gatctttaccccagtatcacttcagatgagtcctatactttagctgtggaaggaccagtg
gcttttctcaaggccaacagagtttggggagtattacgaggtttagagacctttagccaa
ttaatttatcaagattcttatgggactttcaccgtcaatgagtccaacattattgattct
ccacggtttccgcacagaggaattttaattgatacagctagacacttcctgcccattaag
actattcttaaaactctggatgccatggcttttaataagtttaatgttctccactggcat
atagttgatgaccagtctttcccttaccagagcgttgcttttcccgagttaagcaacaaa
ggaagctattctttgtctcatgtgtatacaccaaatgatgtccgtacagtgatagaatat
gcccgattacgagggattcgagtcataccagaatttgatagtcctggacatacacagtct
tggggaaaaggtcagaaaaacctcctgactccgtgttacaatggacctaagcagtctggg
acctttggacctataaaccctattctgaattcaacttactgcttcctgtctcagtttttc
aaagaagttagtacaatgtttccagatcagtttgttcacttgggaggagatgaagtggaa
tttacatgttgggagtccaacccagaagtcatagctttcatgaagaaggcaggctttggc
agagattttcaaagactacagtctttctatattcaaaagcttttgggtatcgtttcaact
ctaaacaagggagccatagtctggcaagaggtttttgatgatcacgcaaagctaaaccca
ggcacagttgttcaagtatggaaaaatgaaatgtatcatgtgacacaagctgcagtcacg
gcagctggcttccctgtgatcctttctgctccttggtacttagattggattagttacgga
caagattggagaaattactataaagtggaccctcttgattttgatggttctcaagaacag
aaaaaacttgtcattggtggagaagcttgtctatggggagaatatgtggatgcaactaac
ctcactccaagattatggcctcgggcaagtgccgttggtgagagactctggagtcaacag
aacatcaaagatatagaggatgcctacgacagactaaccatccaccgctgcagaatgacc
agacggggaatagctgcagaacctctttttactggatactgtaacttttga

DBGET integrated database retrieval system