KEGG   Ailuropoda melanoleuca (giant panda): 100465984Help
Entry
100465984         CDS       T01329                                 

Gene name
HEXB
Definition
(RefSeq) hexosaminidase subunit beta
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00511  Other glycan degradation
aml00520  Amino sugar and nucleotide sugar metabolism
aml00531  Glycosaminoglycan degradation
aml00603  Glycosphingolipid biosynthesis - globo and isoglobo series
aml00604  Glycosphingolipid biosynthesis - ganglio series
aml01100  Metabolic pathways
aml04142  Lysosome
Module
aml_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100465984 (HEXB)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100465984 (HEXB)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100465984 (HEXB)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100465984 (HEXB)
   00511 Other glycan degradation
    100465984 (HEXB)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100465984 (HEXB)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100465984 (HEXB)
Chaperones and folding catalysts [BR:aml03110]
 Intramolecular chaperones
  Others
   100465984 (HEXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 100465984
NCBI-ProteinID: XP_011220631
Ensembl: ENSAMEG00000000487
Position
Un
AA seq 556 aa AA seqDB search
MSQTVRAWTSLKKAEKQDPHSAQLWYLVRLWGRLGKREDKCPGCSSGRRGPSEQRGGHGA
PRAGAAGAAGGAGPVLLENFSIYHDPSSTAGPSCSLLQEAFRRYYDYIFDFNKSRLNPAK
HNSAAELKQLLVSVVLESECDLYPSITSDESYTLAVEGPVAFLKANRVWGVLRGLETFSQ
LIYQDSYGTFTVNESNIIDSPRFPHRGILIDTARHFLPIKTILKTLDAMAFNKFNVLHWH
IVDDQSFPYQSVAFPELSNKGSYSLSHVYTPNDVRTVIEYARLRGIRVIPEFDSPGHTQS
WGKGQKNLLTPCYNGPKQSGTFGPINPILNSTYCFLSQFFKEVSTMFPDQFVHLGGDEVE
FTCWESNPEVIAFMKKAGFGRDFQRLQSFYIQKLLGIVSTLNKGAIVWQEVFDDHAKLNP
GTVVQVWKNEMYHVTQAAVTAAGFPVILSAPWYLDWISYGQDWRNYYKVDPLDFDGSQEQ
KKLVIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSQQNIKDIEDAYDRLTIHRCRMT
RRGIAAEPLFTGYCNF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagacagtgagggcctggacttcactgaagaaagcagagaagcaggacccccac
agcgcgcagctgtggtacctggtgcgtttgtggggccgtctggggaagcgggaagacaag
tgtccaggctgcagctccggcagacgtgggccgagcgagcagcggggtggtcatggagca
ccgcgggctggggctgctggcgctgctggcggcgctggccccgtgctgctggagaacttc
tccatctaccacgacccctcgtccaccgccggcccctcctgctccctcctgcaagaagcg
ttccggcgatactatgactatatttttgatttcaacaagtcacggctcaaccctgctaaa
cataatagtgcagcggagttaaagcaacttctcgtctcagttgtccttgaatcggagtgt
gatctttaccccagtatcacttcagatgagtcctatactttagctgtggaaggaccagtg
gcttttctcaaggccaacagagtttggggagtattacgaggtttagagacctttagccaa
ttaatttatcaagattcttatgggactttcaccgtcaatgagtccaacattattgattct
ccacggtttccgcacagaggaattttaattgatacagctagacacttcctgcccattaag
actattcttaaaactctggatgccatggcttttaataagtttaatgttctccactggcat
atagttgatgaccagtctttcccttaccagagcgttgcttttcccgagttaagcaacaaa
ggaagctattctttgtctcatgtgtatacaccaaatgatgtccgtacagtgatagaatat
gcccgattacgagggattcgagtcataccagaatttgatagtcctggacatacacagtct
tggggaaaaggtcagaaaaacctcctgactccgtgttacaatggacctaagcagtctggg
acctttggacctataaaccctattctgaattcaacttactgcttcctgtctcagtttttc
aaagaagttagtacaatgtttccagatcagtttgttcacttgggaggagatgaagtggaa
tttacatgttgggagtccaacccagaagtcatagctttcatgaagaaggcaggctttggc
agagattttcaaagactacagtctttctatattcaaaagcttttgggtatcgtttcaact
ctaaacaagggagccatagtctggcaagaggtttttgatgatcacgcaaagctaaaccca
ggcacagttgttcaagtatggaaaaatgaaatgtatcatgtgacacaagctgcagtcacg
gcagctggcttccctgtgatcctttctgctccttggtacttagattggattagttacgga
caagattggagaaattactataaagtggaccctcttgattttgatggttctcaagaacag
aaaaaacttgtcattggtggagaagcttgtctatggggagaatatgtggatgcaactaac
ctcactccaagattatggcctcgggcaagtgccgttggtgagagactctggagtcaacag
aacatcaaagatatagaggatgcctacgacagactaaccatccaccgctgcagaatgacc
agacggggaatagctgcagaacctctttttactggatactgtaacttttga

DBGET integrated database retrieval system