KEGG   Ailuropoda melanoleuca (giant panda): 100466029Help
Entry
100466029         CDS       T01329                                 

Definition
pyruvate dehydrogenase [lipoamide] kinase isozyme 3-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100466029
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100466029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 415 aa AA seqDB search
MQVCTLSLKEPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHN
DVVPTMAQGVIEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPAH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSH
LFHMLFELFKNSMRATVELYEDRKEAYPSVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL
FNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSREPRDASKYKAKQDKIKTNRTF
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgtgcacgctctccctaaaagaaccggtccctaagcagatcgaacgctactcg
cgtttctcgccatcgccactctccatcaagcagttcctagacttcgggagagataatgca
tgtgagaaaacttcatatatgtttctacgaaaggagcttcctgtaagactggccaacaca
atgagagaagttaatcttctgccggataacttgcttaaccgcccttcggtggggttggtt
cagagttggtatatgcagagctttcttgaacttttagaatacgagaataagagccctgaa
gatccacaggtcttggataactttctgcaagttctgattaaagtcagaaatagacacaat
gatgtggttcctacaatggcacaaggagtgattgaatacaaggagaaatttgggtttgat
ccattcattagcagtaacatccagtattttctggatcggttctataccaaccgcatctct
ttccgcatgcttattaaccagcacacacttctgtttggtggtgacactaaccccgctcat
cctaaacacattggaagtattgatcccacttgcaatgtggctgatgtcgtgaaagatgcc
tatgaaactgccaagatgctgtgtgagcagtattacctggtagctccggagctggaagtt
gaagaatttaatgccaaagctccagacaaacctattcaggtagtttatgtgccctcacac
ctgtttcacatgctatttgagttgttcaagaactcaatgagagcgacagtcgaactgtat
gaagacagaaaagaagcctacccgtctgttaaaacccttgttactctgggtaaagaagac
ttgtccattaagataagtgacctaggtggtggtgtcccacttcgaaaaatagaccgtctt
tttaactacatgtattcaactgctcctagacctagcctggagcctacaagagctgcccct
ctggctggatttggttatggcttgccaatttctcgtctgtatgctagatatttccaagga
gatctaaaactctattccatggaaggagttggtactgacgctgtcatttatttaaaggca
ctttcaagtgaatcatttgagagacttccggtttttaataagtctgcatggcgtcattac
aagaccacacctgaagctgatgactggagcaatcctagcagagaacctcgggatgcctca
aaatacaaggcgaaacaggacaagatcaagactaatagaactttctag

DBGET integrated database retrieval system