KEGG   Ailuropoda melanoleuca (giant panda): 100466091Help
Entry
100466091         CDS       T01329                                 

Definition
histo-blood group ABO system transferase-like
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100466091
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     100466091
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     100466091
Glycosyltransferases [BR:aml01003]
 Glycan extension
  ABO blood group
   100466091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 363 aa AA seqDB search
MAQLQQILAVTQKCCSRHRVTSLLLLALIMTFLGYKGYLNPRSQKLDSIQAGVSMAIREH
NGLRSVKLSRMVYRQPQVLTPSRKDVLVMTPWLAPIIWEGTFNMDILNEQFQLQNATIGL
TVFSVKAYMIFLKQFLKSAERYFMVGHRVNYYVFTDKPEYVPHLDVRKGRQIIILKIQSY
AHWQDISMHRMEMLSTFSQQRFQREVDYLVCADVDMRLSDHVGVEVLSSLFGTLHVGYYG
LNRADFPYERRPQSQAHIPEDEGDFYYIGALFGGSVSEVFRLTEACHRAIMVDQANHIEA
IWHEESHLNKYFLYHKPSKVLSPEYLWYQQHMNYVKDQNSTSPKVIKRKRFKVLRKNYRL
RDW
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctacagcaaatcctggctgtgacacagaaatgctgttcgcgtcatcgagtg
acctctcttcttctcctagcactcatcatgaccttcctcggctataagggttacctgaac
ccaagaagccagaagctggacagcatccaggccggtgtaagcatggctatcagagaacac
aatggcctgcgaagtgtaaaattatcgaggatggtgtatcgccagccacaggtgctaaca
ccctctaggaaagatgtccttgtcatgaccccgtggctggctcccatcatctgggagggg
actttcaacatggacatcctgaatgagcagttccagctccagaatgccaccatcggactg
actgtattttcggtaaaagcatacatgatcttcctgaagcagttcttgaagtcggcagag
aggtacttcatggtaggacaccgggtgaactactacgtcttcactgacaagccggagtat
gttcctcacctcgacgtccgaaagggaaggcagataatcatccttaagatccagagctat
gcccactggcaggacatttccatgcaccgcatggagatgctcagcactttttcccagcag
cgcttccagcgggaggtggactacctcgtgtgtgcagatgtggacatgcggctcagcgac
cacgtgggcgtggaggtcctctcctccttgttcggcacgctccatgttggctactatggg
ctcaatcgggccgacttcccctatgaacggcggcctcagtcgcaagcgcatattcctgaa
gacgagggggacttttattacataggggccctatttggggggtccgtgtccgaggttttc
aggctcaccgaggcctgccacagagcgatcatggtcgaccaggccaaccacatcgaggcc
atctggcacgaggagagccacctgaacaaatacttcctctaccacaaaccctccaaggtc
ctctcccctgagtacctgtggtatcagcagcacatgaattacgtgaaagaccagaactcg
acgtcgcccaaagtcataaagcggaaaagatttaaagtcttgaggaagaattacaggctg
agagactggtga

DBGET integrated database retrieval system