KEGG   Ailuropoda melanoleuca (giant panda): 100466123Help
Entry
100466123         CDS       T01329                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B31
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00040  Pentose and glucuronate interconversions
aml00053  Ascorbate and aldarate metabolism
aml00140  Steroid hormone biosynthesis
aml00830  Retinol metabolism
aml00860  Porphyrin and chlorophyll metabolism
aml00980  Metabolism of xenobiotics by cytochrome P450
aml00982  Drug metabolism - cytochrome P450
aml00983  Drug metabolism - other enzymes
aml01100  Metabolic pathways
aml05204  Chemical carcinogenesis
Module
aml_M00014  Glucuronate pathway (uronate pathway)
aml_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100466123
   00053 Ascorbate and aldarate metabolism
    100466123
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100466123
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100466123
   00860 Porphyrin and chlorophyll metabolism
    100466123
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100466123
   00982 Drug metabolism - cytochrome P450
    100466123
   00983 Drug metabolism - other enzymes
    100466123
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100466123
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100466123
Glycosyltransferases [BR:aml01003]
 Others
  Hydrophobic molecule
   100466123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4 Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 100466123
NCBI-ProteinID: XP_002929498
Ensembl: ENSAMEG00000005730
UniProt: D2I2P9
Position
Un
AA seq 530 aa AA seqDB search
MSMKWISVLLLLQLSCYFSSGGGGKVLVWPTEYSHWINIKTILDELVQRGHEVTVLTSSA
SILVDPSKSSAIKYEVYPAHLLGNDLEDLFGKLLDTWIYDLPRDTFWAYFSKMQEMMWEF
SDCIQKLCKDVVLNRKLMTKLQESRFDVILADTIGPCGELLAELLKIPLVYSLRFSPGYA
FEKYSGGLPFPPSYVPVILSELSDQMTFMQRVKNMIYVLYFDFWFQTFNEKSWDRFYSEV
LGRPTTFSELMGKAQIWLIRTYWDFEFPRPLLPNFEFVGGLHCKPAKPLPKEMEEFVQSS
GENGIVVFTLGSMIKTMPEERANTIASALAQIPQKVLWRFDGKKPDTLGPNTRLYKWIPQ
NDLLGHPKTKAFVTHGGTNGIYEAIHHGIPMVGIPLFADQPDNIAHMKAKGAAVSVDFHT
MSSTDLLNAVRMVINDTSYKENAMTLSRIHHDQPIKPLDRAVFWIEFVMRHKGAKHLRPA
SHDLTWFQYHSLDVIGFLLACVATAVFVTTQCCLFCYRKCAKRGKKEKKE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggatttcagttctgctgctgctacagctgagctgttacttcagctct
gggggtggtggaaaggtgctggtgtggcccacagaatacagccactggatcaatataaag
acaatcctggatgaacttgtccaaagaggtcacgaagtgacggttctgacatcgtcagct
tccattcttgttgatccgagcaaatcatctgctattaaatatgaggtttatcctgcacat
ttacttggaaatgatttggaggatcttttcggaaaactgctcgacacatggatatatgac
ttgccaagagatacattttgggcatatttttcaaaaatgcaagaaatgatgtgggaattt
tctgactgtattcaaaagctctgtaaagatgtagttttgaacaggaaactcatgacaaaa
ctacaagaatcaaggtttgatgtcattcttgcagatactattggaccctgtggtgagctg
ctggcagagctacttaaaatacctttagtgtacagtctccgcttctctcctggctatgca
tttgaaaagtatagtggagggcttccattccctccgtcctacgtgcctgttattttgtca
gaattaagtgatcaaatgacattcatgcagagagtaaaaaatatgatatatgtgctttat
tttgacttttggttccaaacatttaatgagaagagttgggatcggttttacagcgaagta
ctaggaagacccactacattctctgagttaatggggaaggctcaaatatggctcattcga
acctactgggattttgaatttcctcgcccactcctacccaattttgaatttgttggagga
ctccactgcaaacctgccaaacccctgcctaaggaaatggaagagtttgtccagagctct
ggagaaaacggtattgtggtgtttactctagggtcgatgatcaaaaccatgccagaggag
cgagccaatacgattgcatcagcccttgcccagattccacaaaaggttctatggagattt
gatggcaagaaaccagacaccttagggccaaatactcggctgtataagtggatcccccag
aatgaccttcttggtcatccaaaaaccaaagccttcgtaactcatggtggaaccaatggc
atctatgaggcgatccaccacgggatccccatggtgggcattcctttgtttgcggatcaa
cctgataacattgctcacatgaaggccaaaggagcagctgtcagtgtggatttccacacg
atgtctagtacagatttgctcaatgctgtgaggatggtcattaatgacacttcatacaag
gagaatgccatgacattatcaagaattcaccacgatcagcctataaagcccttggatcga
gcagtcttctggatcgagtttgtcatgcgccacaaaggagccaaacacctcaggccagcc
tcccatgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcc
tgtgtggcaactgctgtatttgtcaccacccaatgttgcctgttttgttaccggaagtgt
gcaaaaagagggaagaaggaaaaaaaggagtag

DBGET integrated database retrieval system