KEGG   Ailuropoda melanoleuca (giant panda): 100466134Help
Entry
100466134         CDS       T01329                                 

Gene name
HDAC3
Definition
(RefSeq) histone deacetylase 3
  KO
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100466134 (HDAC3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100466134 (HDAC3)
  Substance dependence
   05034 Alcoholism
    100466134 (HDAC3)
  Infectious diseases
   05165 Human papillomavirus infection
    100466134 (HDAC3)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100466134 (HDAC3)
Chromosome [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100466134 (HDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcctatttctacgaccccgacgtgggcaacttccactacggggca
gggcaccctatgaagccccatcgcttggcattgacccatagtctggtcctgcactacggt
ctctataagaagatgatcgtcttcaagccgtaccaggcctcccagcatgacatgtgccgc
tttcactctgaggactacatcgacttcttgcagagagtcagccccaccaatatgcaaggc
ttcaccaagagccttaatgccttcaacgtgggtgatgactgcccagtgtttcccgggctc
tttgagttctgttcccgttacacaggcgcatctctgcaaggagcaacccagctgaacaac
aagatctgtgatattgccattaactgggctggtggtctgcaccatgccaagaagtttgag
gcctctggcttctgctatgtcaatgacattgtgattggcatcctggagctgctcaagtac
caccctcgggtgctctacattgatattgacatccaccatggtgatggagttcaggaagcc
ttctacctcactgaccgggtgatgacagtctccttccacaaatatggaaactacttcttt
cctggcacaggggatatgtatgaagttggagcagagagtggccgctactattgtctcaat
gtgcccttgcgggatggcatcgatgaccagagttacaagcaccttttccagccggttatc
aaccaggtggtggacttctaccaacccacatgcattgtgctccagtgtggagctgactcc
ctgggatgtgatcgtttgggctgcttcaacctcagcattcgaggacatggggaatgcgtt
gaatatgtcaagagcttcaatatccctctactggtgctaggtggtggtggctatactgtc
cgaaatgttgcgcgatgctggacatatgaaacatcactgctggtagaagaagccatcagt
gaggagcttccctatagcgaatacttcgagtactttgccccagacttcacgctccatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtatttggaccagatccgccag
acaatctttgaaaacctgaagatgctgaaccatgcacctagcgtccagattcatgatgtg
cctgcagacctcctgacctatgacaggaccgacgaggctgatgcagaggagaggggtcct
gaggagaactatagcaggccagaggcacccaacgagttctatgatggagaccatgacaat
gacaaggaaagcgacgtggagatttaa

DBGET integrated database retrieval system