KEGG   Ailuropoda melanoleuca (giant panda): 100466135Help
Entry
100466135         CDS       T01329                                 

Gene name
SETD2
Definition
SET domain containing 2
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100466135 (SETD2)
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100466135 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2549 aa AA seqDB search
MLSWLDGNREEENEAKIENVQKTGFIKGPMFKGVASSRFLPKGTKTKVNLEEQGRQKVSF
SFSLTKKTLQNRFLTALGNEKQNDTPNSPAGPLQVDLTPKIKMDMGDTLSTTEESSPPKS
RVELGKIHFKKHLLHVTSRPLLTTATAVASPPPPIVPLPAVIAESTTVDSPPSSPPPPPP
PPQATAPSPPAPVTEPVALPHMPIPVLMTAPVDVAVRALKEPPVTTVPESSEVDTKQDAA
VSNSSEEHITQNLNEQVDTPSQKEDSHIGKEEEIPDSSKSNLGSKKTGSKKKSSQSEGTF
LASESDEDSVRTSSSQRSHDLKFSANIEKERDSKKSLAPLKNEDVGKSSRSKTERDDKYF
SYSKLERDTRYISSRCRSERERRRSRSRSRSDRGSRTSLSYSRSERSHYYDSDRRYHRSS
PYRERARYSRPYTDNRARESSDSEEEYKKTYSRRTSSHSFSYRDLRTSSSYSKSDRDCKT
ESSYLEMEKRGKYSSKLERESKRTSENEGMKRCCSPPNELGFRRGSSYSKHDSSASRYKS
ALSKSISKSDKFKNSFCCTELNEEIKTSHSFNLQAPCSKGSELRMISKIPEREKTGSPSP
SNRLNDSPTFKKLDESLIFKSEFIGHDSHDSIKELDSLSKVKNDQLRSYCPIELNINGSP
GAESDLATFCTSKTDTVLMSSDDSVTGSEVSPLVKACMLPSNGFQNINRCKEKDSDDTCM
LHSKSGSPFREAEPPVSPHQDKLMSLPVMKIDYSKTIVKEPVDMTVSCCKTKDSDIYCTS
NDNSPSLHHSEAEKIEPSATQISPNSFMNVHLKSKTVTYDNRNLTDQRSKFACEEYKQSV
GSTSSASVNHFDDLYQPIESSGIASSLPSLPPGIKVDSLTLLQCGENTSPVLDAVLKSKS
TEFLKHAEKETVEVGSGLPDSGKGFASWENRHNNGLSGKCVQEAQEEGNSILPDRRGRAE
ISLDEEGGREHAHTSDDSEVVFSSCDLNLTMEDSDGVTYTLKCDSSGHASEIVSTVHEDY
SGSSESSSDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLPMEETSPCSSRSSQSYRHYS
DHWEDERLESRRHSYEEKFESVASKPYSQTEKFFHHKGTEKNLEISFTQPSRKQIDNHLS
ETAHPQSDGVDSTSHTDVKSDFLGHPNSEETAKTKIASRQQEELPVYSSDDFEDVPSKSR
QQITFPNRPDSRLGKTELSFSPSCEISRVDGFRSSEELRSLGWEFSQQEKPTTTYQQPDS
SYGACGGHKYQQSAEHYGGTRNYWQGNGYWDPRSAGRPPGTGVVYDRIQGQVPDSLTDDR
EEEEIWDQRGGSHFSSQSNKFFLSLQKDKGSVQAPEISSNSIKDTLAVNEKKDLPKNLEK
NDMKDRGPPKKRRQELESDSESDGELQDRKKVRVAVEPGEIAVPPGSALVGPSCVMEDFR
DPQRWKEYAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQGEIA
CGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTF
VLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNC
ETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRV
SIRAAGGKMKKERSRKKDTVDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCL
ELIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEHLPIPTKNML
EESKVLPIIQRWSQTKTAIPQLSEGDGYSSENTSRAHTPLNTPDPSTKLSIEADTDTPKK
LMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPVEEEEELQSQQLLPQQLPE
SKVESEITVEASKLPTSEPEADTEIEPKEGNGTKLEETIAEETPSQDEEEGVSDVESERS
QEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENTITERGRDAVGFRDQTAAPK
TPNRSRERDPDKQTQNKEKRKRRGSLSPPSSAYERGTKRPDDRYDTPTSKKKVRIKDRNK
LSTEERRKLFEQEVAQREAQKQQQQLQTLGMTSPLPYDSLGYSAPHHPFAGYPPGYPMQA
YVDPSNPNAGKVLLPTPNMDPVCSPAPYDHSQPLVGHSTEPLAAPPPVPVVPHVAAPVEV
SSSQYVAQSDGVVHQDSSVTVLPVPAPGPVQGQNYGVWDSNQQSVSVQQQYSPAQSQATI
YYQGQTCPTVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQGVVVQPAAAVTTI
VAPGQPQPLQPPEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQT
QWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKEVFR
KEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNEN
VKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7650 nt NT seq  +upstreamnt  +downstreamnt
atgctttcttggctggatggcaatagagaagaagaaaatgaggcaaagattgaaaatgtg
cagaaaacaggtttcatcaaaggaccaatgttcaaaggtgttgcttctagtcgattttta
cccaaaggcaccaagacaaaagttaatttggaggaacagggacgacagaaggtgtctttc
agcttcagccttacaaagaaaactttgcagaacaggtttctgactgcacttggcaatgaa
aagcaaaatgatactccaaactccccagctggacctcttcaagtagacttgacccctaaa
attaaaatggacatgggagataccttatctactacagaagaatcttctccaccaaaatcg
agggtagaattgggcaaaattcattttaagaaacatctacttcatgtgacctccaggcca
ctgctgactactgccacagcagtggcctccccacctcctcccatagtaccattaccagca
gtcatagcagaatcaacaactgtagactcgccaccctcatctccacctccaccacctcca
cctccccaggccacagcaccctcaccaccagcaccagtaacagagccagtggccttgccg
cacatgccaatcccagttctaatgacagcaccagtagatgtagcagttcgagcactgaag
gaaccaccagttacgactgtaccagaatcttcagaagtggacactaagcaggatgctgct
gtatctaatagttcagaagaacacataactcaaaatttgaatgagcaagtagatactccc
tcacaaaaagaagattcccatattgggaaggaagaagaaattccagatagttctaagagt
aatctgggctccaaaaaaacaggttctaagaagaaatcctcacaatctgaaggcaccttt
cttgcttcagaatctgatgaagattctgtacggacttcctcaagtcaaagatcacatgat
ttaaaattttcagcaaacattgaaaaggaaagagattcaaaaaagagcttagcaccttta
aaaaatgaggacgtagggaaatcgtcacgatctaaaacagagagagatgataaatatttt
agctattcaaaacttgaaagagatactcggtatatatcttctcgatgtagatcagagaga
gagcgaaggcggagcagatctcgttctagatctgacagaggctctagaactagtttatcc
tattcccggtccgaacgatcccattattatgactctgatcgtcgctaccatcggagttcc
ccttatcgagagagggcacgctattctcggccatatacagataacagagctcgagagagc
tctgactcagaagaggagtataagaaaacctactcaaggcgcacctcctctcattccttc
tcttacagagacctaaggacatcatcatcctattctaaatctgatcgggactgcaaaact
gagtcctcttacttagagatggagaagagaggaaagtattcttcaaaactagaaagagaa
tccaaaaggacttcagaaaatgaaggcatgaaaagatgttgttctccccctaacgaactg
ggattccgacgggggtcatcctattccaagcatgatagcagtgcttcccgttataaatct
gccctttcaaaatctatatccaagtctgataaatttaaaaattctttctgttgtacagaa
ttaaatgaggaaatcaaaacgtctcattcttttaatttacaggctccttgttcaaaaggt
agtgaattaagaatgattagtaaaattcctgaaagagaaaagactgggtctccatctcca
tcaaatcgattaaatgattcacctacttttaaaaagctagatgaatcacttatttttaaa
tctgaatttataggacatgatagccatgatagtattaaggaattagactctttatctaaa
gtgaagaatgatcaattaagaagttattgtcccatagaattaaatataaatggatctcct
ggggcagaatctgatttggcaacattttgcacttctaaaactgacactgttttgatgtct
tctgatgatagtgtgactggatcggaggtatcccctttggtcaaagcatgcatgcttcca
tcaaatggatttcagaatattaatagatgtaaagagaaagactcggatgatacttgcatg
ctgcatagtaagtcaggaagcccatttagggaagcagaacctccagtgtcgccacaccaa
gataaactcatgtctttgccagttatgaagatagattattctaaaactatagttaaagaa
ccagttgatatgacagtttcttgctgtaaaaccaaagattcagatatatactgtacttca
aatgacaacagcccttctttgcatcattctgaagctgaaaagattgagccttcagctacg
cagatttctccaaatagctttatgaatgtgcatttgaaatcaaaaacagttacatatgat
aatagaaatctgacagatcagcgctcaaaatttgcatgtgaagaatataagcagagtgtt
ggtagcactagttcagcttctgttaatcattttgatgatttatatcagcctatagagagt
tcaggcattgcttcatctcttccaagtcttccaccaggaataaaagtggacagtttaact
ctcttgcaatgtggagagaacacatctccagttttggatgctgtgctgaagagtaaaagc
acagagtttttaaagcatgcagagaaagaaacagtagaagtaggtagcggcctgcctgat
tcaggaaagggatttgcttcttgggaaaataggcataataatgggttatctgggaaatgc
gtgcaagaggctcaagaagaagggaattccatattgcctgatagaagaggaagagcagaa
atctctttagatgaagaaggaggaagagaacatgcgcatacttctgatgactcagaagtt
gtattttcttcttgtgacttgaatttaaccatggaagacagtgatggtgtaacatatacc
ttaaaatgtgacagtagtgggcatgcctcagagattgtatctactgtccatgaagattat
tctggttcttctgaaagttcaagtgatgaaagtgactctgaagatacagattctgatgat
agcagtattccaagaaaccgtcttcagtctgttgtggtagtgccaaagaattctactttg
cccatggaagaaacaagtccttgttcttctcggagcagtcaaagttacagacactattct
gaccactgggaagatgagagattggagtcaaggagacattcatatgaggaaaaatttgag
agtgtagcaagcaaaccctattctcaaactgagaagttcttccatcataaagggacagag
aagaatctggaaatttctttcacacagcccagcagaaaacaaatagataaccacctgtct
gaaacggctcatcctcagagtgatggggttgatagtacaagtcatacagatgtgaaatct
gactttctaggtcatccaaattctgaggaaactgcaaaaaccaaaatagcttctaggcag
caagaagagctgccagtttattcttctgatgattttgaagatgtcccaagtaagtctcgg
caacagatcactttccctaacaggccagatagtagactgggaaaaacagagttgagtttt
tctccctcttgtgagatctcccgagtggatggtttccgctcatcagaagagctccgaagc
ctagggtgggagttctctcaacaagaaaagcctactaccacataccaacaaccagacagc
agctatggagcctgtggtggacacaagtatcagcaaagtgcagaacattatggtgggaca
cgtaattactggcaaggcaatggctactgggatcccagatcagcaggtagacctcctgga
actggggttgtgtatgatcgaattcaagggcaggtaccagattccttaacggatgatcgt
gaagaggaggagatttgggatcaacgtggaggatctcatttttcaagccagtccaataag
ttttttctatcccttcagaaggacaaagggtcagtacaagcacctgaaataagcagcaat
tccattaaggacactctagctgtgaacgaaaagaaagatcttccaaaaaacttagaaaaa
aatgatatgaaagacagagggcctcctaaaaaaaggagacaggaattggagagtgattct
gaaagtgatggtgaacttcaggacagaaagaaagttcgagtggcggtagagccgggggaa
atagcagtacccccaggctcagcactggttggaccttcttgtgtcatggaggacttcagg
gacccacagcgatggaaagaatatgccaagcaagggaagatgccctgttactttgatcta
attgaagaaaatgtttatttaacagaaagaaagaagaataaatctcatcgggatattaag
cggatgcagtgtgagtgtacaccgctttctaaagatgaaagagctcaaggtgaaatagca
tgtggagaagactgtcttaatcgtctcctcatgattgaatgttcttctcggtgtccaaat
ggggattattgttccaatagacggtttcagagaaagcagcatgcagatgtggaagtcata
ctcacagagaagaaaggctggggcttgagagctgccaaagaccttccttcgaacaccttc
gtcctagaatattgtggagaagtacttgatcataaagagtttaaagcccgggtaaaggaa
tatgcacgaaacaaaaacatccactactatttcatggccctgaagaacgatgagataata
gatgccactcagaaaggaaactgctctcgtttcatgaatcacagctgtgaaccaaactgt
gaaactcaaaaatggactgtgaatggacaactgagggttgggttttttaccaccaaactg
gttccttcaggctcagagttaacatttgactatcagttccaaagatatggaaaagaagct
cagaaatgtttctgtgggtcggctaattgccgaggttacctgggaggagagaacagagtc
agtatcagagcagcaggaggaaaaatgaagaaggagcgatcccgtaagaaggatacagtg
gatggagagctagaagctctgatggagaatggtgagggtctctctgataaaaaccaggtg
ctcagcttatcccggctgatggttagaattgaaactttggagcagaaacttacctgtctt
gagctaatacagaacacacattcacagtcttgtctgaagtctttcctggaacgtcatggg
ctgtctttgttgtggatctggatggcagaactaggtgatggccgggaaagtaaccagaag
cttcaggaagagattataaagactttggaacacttacccattcctactaaaaatatgttg
gaggaaagcaaagtacttccaattattcagcgctggtctcagaccaaaactgccattcct
cagttgagtgaaggagatgggtattcaagtgagaatacgtcacgtgctcacacgccactc
aacacacctgatccttccaccaaactgagcatagaagctgacacagacacccccaagaag
ctcatgtttcgcagacttaaaattataagtgaaaatagcatggacagtgctatctctgat
gctaccagtgagctggaaggcaaggacggcaaagaggaccttgaccagttagaaaacgtc
cctgtagaagaagaggaagagttacagtcacaacagctactcccacagcagctacctgaa
tctaaagttgagagtgaaatcactgtggaagccagtaagctacccacatctgaaccagag
gctgacactgaaatagagcccaaagagggcaatggcacaaaactggaagaaaccattgct
gaggaaaccccgtcccaagatgaagaggagggtgtatctgatgtggagagtgagaggagc
caggaacagccagataaaacagtagatataagtgatttggccaccaagctcctggatagt
tggaaagacctaaaggaggtatatcgaattccaaagaaaagtcaaactgaaaaggagaac
acaataactgaacgaggaagggatgctgttggcttcagagatcaaacagctgccccaaag
actcctaacaggtcaagagagagagacccagacaagcaaactcaaaataaagagaaaagg
aaacgaaggggctctctctcaccaccttcttctgcctatgagcggggaacaaaaaggcca
gatgacagatatgatacaccaacttctaaaaagaaagtacgaattaaagaccgcaataaa
ctttctacagaggagcgtcggaagttgtttgagcaagaggtggctcagcgggaggctcag
aaacaacagcagcagttgcagaccctgggaatgacatctccactgccctatgactctctt
ggttacagtgcccctcatcaccccttcgctggctacccaccaggttatcccatgcaggcc
tatgtggatcccagcaaccctaatgctggaaaggtgctccttcccacgcccaacatggac
cccgtgtgttctcctgctccttacgatcattctcagcccttggtgggacattctacagaa
ccccttgctgcccctccacctgtgccagtggtgccccacgtggcagcccctgtggaagtt
tccagttcacagtatgtggcccaaagtgatggtgtggtacaccaagactccagcgtcact
gtcttgccagtgccagccccaggcccagtccaaggacagaattatggtgtttgggattca
aaccaacagtcagtcagtgtccagcagcagtattctcctgcacagtctcaagcaaccata
tattatcaaggacagacttgtccaactgtctatggtgtgacatcaccctattcacagaca
actccaccaattgtacagagttatgcccagccaagtcttcagtatatccagggacaacag
attttcacagctcacccgcaaggagtggtggtccagccagctgcggccgtaacgacaata
gtcgctccagggcagcctcagcccttacagccacctgaaatggtagtgacaaataatctt
ctggatctgccacccccctctcctcccaaaccaaaaaccattgtcttacctcccaactgg
aagacagcccgagatccagaagggaagatttattactaccatgtgatcacaaggcagact
cagtgggatcctcctacttgggaaagcccaggagatgatgccagccttgagcatgaagct
gagatggacctgggaaccccaacatatgatgaaaaccccatgaagacctcgaaaaagcct
aagacagcagaagcggacacctccagtgagctggctaagaaaagcaaagaagtattcaga
aaagagatgtcccagttcatcgtccagtgcctgaacccttaccggaaacctgactgcaaa
gtgggaagaatcaccacaaccgaagacttcaagcatctagctcgcaagctgactcatggc
gtgatgaataaggagctgaagtactgtaagaaccctgaggacctggagtgcaatgagaat
gtgaaacacaaaaccaaggagtacattaagaagtatatgcagaagtttggggccgtttac
aaacccaaagaggacactgaattagagtga

DBGET integrated database retrieval system