KEGG   Ailuropoda melanoleuca (giant panda): 100466340Help
Entry
100466340         CDS       T01329                                 

Definition
(RefSeq) probable maltase-glucoamylase-like protein
  KO
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100466340
   00500 Starch and sucrose metabolism
    100466340
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100466340
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100466340
    3.2.1.20  alpha-glucosidase
     100466340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2372 aa AA seqDB search
MARKLSILEVLLIIFFLTVLALDIFLMFFVFQKDEEAEFVPECPEIPESDRIDCAPGQVV
TEDVCRQQHKCCWKPVPDTNVPRCFFPRNWGYEANSIQNDTSTGFTAQLRKLPFPSLFGY
DVRDATFTAEYQTSNRFHFKISDTDNKRYEVPPEIINLSERTTNTSNLNYYIEVIDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSTAVYGLGEHVHQQYRHNMTWKTWPI
FTRDAAPTEGMINLYGAHTFFLCLEDTSGSSFGVFLLNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELIGRPFLPPYWSLGFQLSRRNYSGISGLKKVVDRNRVAGI
PYDVQYSDIDYMDGNKDFTVDKQAFPNLSDFTSDLHKQGLKYVIVMNPGILNNSDYPPYM
NGRTKRVWILGDNGFVVGQGYPGWTVFPDYSNPICTQWWKEQLSEFHQSLEFDGVWIEMD
EVSSFLQGSDRGCEWNTFNFPPFTPRILDRLLFARTLCMDAEFQWGLHYDVHSLYGYSMA
KATHSAMENIFPNKSSFILSRSTFAGSGKYAAHWLGDNAATWNDLRWSIPSILEFNLFGI
PMVGANICGYTKNVTEELCTRWMQLGAFYPLSRNHNGPGFRDQDPAAFGEHSLLVHSSRY
YLNIRYALLPYLYTLFYRAHARGDTVARPLVHEFYQDPATWDVHEQFLWGPGLLITPVLY
EGMDRVKAYIPDAIWYDYETGVAVQWRKQWVEMLLPLDKIGLHLRGGFIFPTQQPNTTTE
ASRKNSLGLIVALDYKREAWGELYWDDGVSKDGEKQYILYDFSVSSNRLQANIINNSYMD
PNNLMFTDIIILGMDKQPTDFTVLLSNSATSISNVAYNVSSKVVEISDLKGLILGQGFSI
EWKLPVSDLEKFNCYPEDAAVSEESCKQRGCLWESTAVPDVPTCYYDTIPSYAASNIQYL
PTGITTDLAHLGAPESARAASRSLSAAVSFLRLSVVYHTENMLQFKIFDSMNKRYEVPVP
LNTPPSPVGSPEDRLYDVRIQNNPFGIQIRRKSSSTVIWDSQLPGFTFNDMFLSISTRLP
SQYIYGFGETEHTAFRRNMNWTMWGMFARDEPPAYKKNSYGVHPYYMALEEDGSAHGVFL
LNSNAMDVSFQPTPALTYRTTGGILNFYMVLGPTPELVTQQYTELIGRPAMTPYWALGFQ
LSRYGYQNDTEISHLYEAMMAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLSVLIEQMKN
NGMRFILILDPAISGNETQYRPFTRGQDNNVFIKWPNSNDIVWGKVWPELPNVNVNTSLD
HETQVKLYRANVAFPDFFRNSTAAWWKLEIKELYANSQESGKSLKFDGLWIDMNEPSNFV
DGSVRNCSDDILNNPPYVPYLESRDKGLSSKTLCMESEQVLPDGSQVRHYDVHSLYGWAQ
TRPTYEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTASWDQLRKSIIGMMEFSLFGI
SYTGADICGFFGNAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVAWNSTFEVFSRKVL
QTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTNDNKTWDIDRQFMLGPALLISPVLESN
TSEISAYFPRARWYDYSTESGSVSTGEWKALGAPLDHINLHIRGGCILPWQEPAMNTHSS
RQKFMGLTVALDDNGKAEGQIFWDDGESIDTYENGNYFLAKFTAAQNLLKIQTIHNKYLS
DSNPLKVGYIKIWGTNSTSVTQVTFTYDNQQFTEMNFKSDPYNQTLTIQLTDKIISLEKL
TEVTWIYGGPIVSTTPMTNTFTTGSLYPSTVTTKATTFETILTSFATTSTTLSISTTAFP
TSTTEVTASTTGPSTTTPFLTSTIEVITSSNVPNTTTPSPPNTTATTTDFTAVPNTTTPS
PPNTTASSTTLPITGTPFPTGTTGFTASTPVPNTTTPSPPNTTASSSTLPITGTPFPTGT
TGFTASTPVPNTTMPSPPNITTSSSTLPITGTPFPTGTTGFTASTPVPNTTMPSPPNTTA
SSSTLPITGTPFPTGTTDFTAYTPVPNTTMPSPTSTTTASTSTTLPITSSPVPESTIDVT
TSTAVTNTTLPSPISTTASISTTLPIITTAFPTSNTEAITNTTVLITTTLSPTSTDTTST
NNTVPITTTPSTNGSANSTINGFPIMTTFSVTTHAMNTTVAMVTTSPISTDVARTGNHTP
ITSSPSPTISGGNSTSYTIPTMSTLSTDIYTTSTNTIATPTTKTIHSTGHEVNITDTDNS
SSVPDNTTRVSIPNTTIALDTLMTALLDTEAHHQVTTNSTVSYLPIIVTNATTSIINTTA
YALNTTILDRPMNASATIPTYIANAVNATLVP
NT seq 7119 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaaactcagtatattggaagtccttctgatcatcttcttcctaactgtactg
gccttagatatcttcttgatgttttttgtgtttcagaaagatgaagaggctgaatttgtt
ccagagtgtccagagatccctgaatcagacaggatagactgtgctccaggccaggtggtg
acagaggatgtctgcaggcagcaacataagtgctgctggaaacctgtgccagacactaat
gtccctaggtgcttcttccccaggaactggggctacgaagccaacagtatccagaatgac
acaagtacagggtttacagcccagttgagaaagttgccattcccatctctgtttggatat
gatgtgagggatgccaccttcacagctgaatatcagacatccaatcgttttcattttaag
attagtgatactgacaacaaacgctatgaagtcccccctgaaattattaacctgtctgag
aggactactaatacttccaatttgaactattacatagaggtcattgataagcccttcagc
atcaaaataatgaggacgagcaacagaagagtcctattggacacgagcatcgggcccctg
cagttcgcccagcagtacctgcagctgtccttccgtctgcccagcaccgccgtgtacggg
ctgggggagcacgtgcaccaacagtaccgccacaacatgacctggaagacctggcccatc
ttcacccgcgatgccgcccccaccgagggcatgattaatctgtatggagctcatacattc
ttcctgtgccttgaagacaccagcggctcctcttttggggtttttctattgaacagtaat
gccatggaggtcaccctgcagcctgctcctgcgatcacttaccgcacgattgggggcatc
cttgacttctatgtattcctgggaaatactccggaacaagtggttcaggaatacctggag
ctcattggacgaccattcctgcctccctactggagtcttgggttccagcttagtcgcagg
aactatagtggcatcagtggattgaagaaggttgtggatcgaaatcgtgtagctgggatc
ccttatgatgtccagtactctgacatagactacatggatggaaataaggatttcactgtc
gataaacaggctttccctaatctctcagattttaccagcgacttacataagcaaggactg
aaatatgtaatcgttatgaatcctggcatcttaaataactctgactaccccccatatatg
aatggaaggacaaagagagtatggatcttgggggacaatggctttgtcgttgggcaggga
taccccggatggaccgtctttccggattacagtaatccgatttgcactcagtggtggaag
gagcagctcagtgaatttcatcaaagtcttgagtttgatggagtgtggattgaaatggat
gaagtatccagctttctccaaggttccgatcgcgggtgtgaatggaacaccttcaacttt
cctcctttcactccccgaattctggaccgcttgctttttgcaagaaccctctgcatggat
gcagaatttcagtggggccttcactatgatgtccacagcttgtatggctactctatggca
aaagcgacacactcggccatggagaatatcttccccaacaaaagtagcttcatcttatcc
cgctctacttttgctggatctggcaaatatgctgcacactggttgggggacaatgcagcc
acatggaatgatctccgatggtccatccctagtatccttgagttcaacctatttggtatc
cccatggtaggtgccaacatctgtggttacacaaaaaatgtcacagaggagctctgcaca
agatggatgcagcttggagcattttatccactatcgaggaatcacaatgggcctgggttc
agggaccaggatccggctgcctttggcgaacactctctgctggtgcattcctccagatat
tatctgaacatccgctacgccctgctgccctacctctacaccctcttctaccgagctcac
gcccggggggacaccgtagccaggcccctggtccatgagttctaccaggacccagctact
tgggatgtgcacgagcagttcttatgggggcctggactcctcatcacacctgttttatat
gagggtatggaccgagtgaaagcatacataccagacgccatctggtacgactatgagaca
ggagtagccgtccagtggaggaaacaatgggtggagatgctgctgccactcgacaagata
ggacttcatctccgagggggcttcatatttcccacccagcagcccaacacaaccacagag
gccagtcggaagaattccctgggactcattgttgccttggactacaagagagaggcatgg
ggcgagctgtactgggatgatggtgtgtctaaagatggtgaaaagcagtatattctatat
gacttttctgtcagctctaaccgtcttcaggcaaatattataaataatagctatatggac
cctaacaacctcatgtttacagatatcataatcttgggaatggacaagcaacctactgat
tttaccgtcttacttagtaattctgccacctccatttcaaatgttgcctacaatgtttca
tcaaaggtggtggagatcagtgatctcaagggactgatacttggtcaaggattctccatt
gaatggaaacttccagtcagtgacctggagaaattcaactgctaccctgaggatgctgcc
gtctctgaagagagttgcaagcagcgggggtgcctttgggagtccacagctgttcctgat
gtgcccacctgttactacgacaccatccctagttatgccgccagtaacattcagtacctg
cctacgggcatcaccacagaccttgcccacctcggggcccctgaatcagcccgtgctgcc
tctcgctcgctctctgcggcagtcagcttcctccggctgagcgtggtctaccacacagaa
aacatgctgcagttcaagatctttgattccatgaacaaaaggtatgaggtcccagtgcct
ctaaacacccctccctctccagttggctcccctgaagaccgtctgtatgacgtcaggatt
cagaacaatccttttgggatccagattcgacgaaaaagctccagcactgtgatttgggat
tctcagctgcctggcttcacgttcaacgacatgttcctctccatttctactcgcctcccc
tctcagtacatctatggctttggggagacggagcacacagctttcagaagaaatatgaac
tggaccatgtggggaatgtttgctcgtgatgagcccccagcgtacaagaagaattcctat
ggcgtccacccctactacatggcactagaggaagatggcagtgcccatggggtgttcctg
ctaaacagcaatgccatggatgtgtcattccagcccactcctgccctgacataccgcacc
acaggagggattttgaacttttatatggttttggggccaacccctgagcttgtaactcaa
caatacactgagctgattggtcggccggcaatgactccatattgggccttgggattccag
ctaagtcgctatggataccagaatgatactgagatctcccacttgtatgaggcaatgatg
gcagcccagattccctatgatgtccagcatgtagacatcgattacatggacaggaagctg
gacttcactctcagccccagcttccaaaacctcagcgtcctgattgagcaaatgaagaat
aatggcatgagattcattctcattctggacccagccatttctggcaacgagacccagtat
cgcccattcaccagagggcaggataacaatgtattcatcaaatggcccaacagcaatgac
attgtctggggaaaggtttggccagaactgcccaacgtgaatgtgaatacctcccttgac
catgaaactcaggttaagctgtacagagccaacgttgcttttcccgacttctttcgtaat
agcacagctgcatggtggaagctggaaataaaagagctctatgcaaattctcaagagtca
gggaagagcttgaagtttgacggattgtggattgatatgaatgagccatcaaactttgtg
gatggatctgtcaggaactgcagtgatgacattcttaataacccaccctacgtgccatat
ttggagtccagggacaagggcctgagcagcaagaccctgtgcatggagagtgagcaggtc
ctgccagacggctcgcaggtgcggcactacgacgttcacagcctgtacggatgggcccag
accagacccacctacgaagctgtgcaggaggtgacgggacagcgaggggtcgtcatcacc
cgctccacattcccctcttctggccgctggggaggccactggctgggtgacaacacagcc
tcgtgggaccagctgaggaaatcgatcattggcatgatggagttcagtctcttcggaata
tcgtatacaggagcagatatttgtggcttctttggaaatgctgagtatgagatgtgtgtt
cgctggatgcaactgggggccttttatcccttttccagaaaccacaacaccatcgggaca
aggagacaagatcctgtggcctggaattcaaccttcgaggtgttctccagaaaagtcctt
cagaccagatacaccctgttgccctacctctacactttgatgcataaagctcacgttgag
ggcagcactgtcgtccgaccccttctccatgagtttacgaatgacaacaaaacatgggat
atagaccgtcagttcatgttgggtcctgctctcttaatcagccccgtgctggaaagtaac
acttctgagatctctgcttactttcccagagcccgttggtatgactacagcacggaatct
ggcagtgtgtcaacaggtgagtggaaagcactgggtgctccccttgaccacatcaacctt
catatcagagggggctgcatcctgccttggcaagagcctgcgatgaacactcactccagt
cgacaaaaatttatgggattgactgttgcattggacgacaatgggaaggctgaaggccag
atattctgggatgatggagaaagcattgatacctatgaaaatggaaactatttcttggca
aaatttacagcagctcagaatctattgaaaatccagaccatacacaataagtatttgagt
gactcgaatccactgaaagttggatatattaaaatctgggggacaaactctacttctgtg
acacaagtcactttcacctatgacaaccagcaattcacagagatgaatttcaagagtgac
ccttacaatcagactctgactattcaactgactgacaagattatcagcctagaaaaacta
actgaggttacttggatatacggtggccctatagtttctactacacctatgacaaatacc
ttcacaacaggttctctatatccttctacagttactactaaggctaccacttttgagact
attctcactagttttgctactactagtactactcttagtatctcaaccactgctttccca
acaagtactactgaagttacagctagtactactggccctagtaccactacacctttccta
acaagtactattgaagttataactagttctaatgttcctaataccactacgccttccccc
ccaaatactaccgctactactactgactttacagctgttcctaataccactacgccttcc
cccccaaatactaccgctagcagtactactcttcctatcacaggcactcctttcccgaca
ggcactactggctttacagctagtactccggttcctaataccactacgccttccccccca
aatactaccgctagcagtagtactcttcctatcacaggcactcctttcccgacaggcact
actggctttacagctagtactcctgttcctaataccactatgccttcccccccaaatatt
accactagcagtagtactcttcctatcacaggcactcctttcccgacaggcactactggc
tttacagctagtactcctgttcctaataccactatgccttcccccccaaatactaccgct
agcagcagtacccttccaatcaccggcactcctttcccaacaggtactactgactttaca
gcttatactcctgttcctaataccactatgccttccccaacaagtaccactactgctagc
actagtactacccttcctatcacaagctctcctgtcccagaaagcactattgatgttaca
actagtactgctgttactaataccactctgccttcccctataagtaccactgctagcatt
agtactactcttcctatcataaccactgctttcccaacgagtaatactgaagctatcacc
aataccactgttctaattaccactactctttctccaacaagtactgatactactagcacc
aataatactgttccaattacaactactccttctacgaatggtagtgctaatagtactatc
aatggttttcctattatgactactttttctgtaactactcatgctatgaacactactgtt
gctatggtaaccacttctcctataagtactgatgttgctcgcactggcaaccatactccc
attaccagttctccttcccctacaatatctggtggtaatagtactagttatactattcct
acaatgtctactctttctacagatatttacactactagcactaataccatagctacccct
accaccaaaactatacatagtacagggcatgaagtaaatattactgacacagataactct
agcagtgttccagataacactacacgtgtttctattccaaataccacaatagccttagac
acattaatgactgctcttctagacacagaagctcaccatcaggtaacaacaaactctaca
gtcagttatttacctattattgtaactaatgctaccaccagtattataaatactaccgca
tatgctctaaatactaccattcttgatagaccaatgaatgcttctgctaccataccaact
tatattgcaaatgccgtaaatgctactctagttccatga

DBGET integrated database retrieval system