KEGG   Ailuropoda melanoleuca (giant panda): 100466438Help
Entry
100466438         CDS       T01329                                 

Gene name
POM121L2
Definition
POM121 transmembrane nucleoporin-like 2
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100466438 (POM121L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1019 aa AA seqDB search
MGSYLGKPGSPPSSPAQARTDVAERPPNRRPAQPLHQVRRLPHAHRAHPALRHRPARRPP
SWAPAGAKAAAAGEAWRRFPMPRSQNSIVGPLPSDWWDSYLKRTVWSLRHPRAAGSPVTI
RIAPPERRALPCPSPAEVVDSAGSSPSEKPPDPCAKETVLRALRECKKGRVKFEEALVSE
GWPSERSPDTRPSAFKPLVEKGVLTSFVPRPGPLKRSLEPGGSDHSLSKRPSCSSLSSVA
GAHPAGPLGARRNAITSSYSSSRAFSEPWKRSAPRESPQTPEWPVKKKGKGHQCHSPIPL
ESDESPAASGGSGQQSQIPWQLSSPGDLLSLTPTPQLGDAVPEEDLASGKKGGLQGSGKA
RDERTEVTTDSVSETCSALQPCLCLTPPSAGTAPTQGFTKLPESPPALPPSPGEAVSTAH
SPVKEGSLRSSQGCSQAEPLPGASSAAFILPTPASPTSPLTDTTGPPSTSQADRTTMPPG
LPALSSAELSVQSTLSGMSSPAPHLSASPPPAIASANPTSNPILGPPPKSEIGGSLYSRT
SVTTTTPATLSIFTPSFKPIFGGVGPLKTMPMIAPFKQTSPLATPASTHLLHGLVKATSV
VVSTTAASTSKDSSFMPPLDFGVVNVSSTTENTYTIPSTCHTFLLGAACAFRASFAPATG
FVFPPHQRATIPTVHTVTIFSQVLSSAVQISPSKTTANFRGVGSPLSTSALVTTHQASLS
SSISSPTSAFAVPLGSGSRPPFPLSPGATLQLAFGATGGQKQGAVQPTLGPSFSSPFIFG
NSAVASPTPTSTPAQPAFSSTTQSPFGGLTPSASTCHLPAGTLPNFGSTPAGFLFGQAST
TGLRVVAQTHQNGACGSVFGSTAPRPFAFGGLMTPMDCGDSGIGGTAPDMSSNPGAFSVG
TVPSGTTGTMTPFGKGCSQNTPGLTNQSTPSVLGMAGISARKTMFGAPCMSPFAQSTLVP
GPVTTSSSLGFGMPSPPPQSCAGRGPFTSSASSFSIGAKSKTPKNREQGHSRRHHAHKK
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgggcagttacctgggcaagccggggtccccgccgtcgtcccccgcgcaggcgcgcaca
gacgtggcggagaggccgccgaaccgccggcccgctcagccccttcatcaagtccggcgg
cttccgcacgcccaccgcgcccaccctgccctgcggcacagacctgccaggaggccgccc
agctgggctccggcgggtgccaaggccgcggcggccggggaggcttggcggcgctttccc
atgcccaggtcccagaattccatcgtggggcctcttccctcggactggtgggacagttac
ctcaagcggactgtttggtctcttcggcaccccagggcagcagggagcccggtgaccatc
aggatagcccctcccgagcggagagcgctcccctgcccctctcccgcggaggtggtcgac
tctgcagggtcctcaccctctgagaagcccccagacccgtgtgcaaaggagacggtgctg
agggccctccgagagtgcaagaaagggagagtgaagtttgaagaagcgctggtttccgag
ggctggcccagtgagaggagtccagacaccagaccgtccgcatttaagcccctggtggaa
aagggagttctcacttcttttgtgcccaggcctgggcccctgaagagaagcctcgagccg
gggggctccgatcacagtttgagtaagaggcccagttgctcctccctgagctccgtggcc
ggcgcacacccagctggcccgctcggtgccagaagaaacgctatcacaagttcttacagc
tcttctagggctttctctgagccttggaagagaagtgctcccagggaatccccgcagaca
ccagaatggccagtgaaaaagaaaggaaagggtcatcagtgtcactctccgatcccactg
gaatcagacgagtccccagcagcatccggcggctccggacagcaaagtcagattccatgg
cagctctctagtcctggggacctgctgtcactgaccccaactccccagcttggcgacgca
gtccctgaagaggacctggcctcagggaagaaaggtggactccaggggagcggtaaagcc
agagacgagaggactgaggtcaccacggactctgtctctgagacgtgctctgctcttcag
ccttgcctgtgtcttaccccgccttctgcaggcacggctccgacccagggcttcacaaaa
ctgccggagtctcccccggccctcccaccatcccccggagaggcagtcagtacagcgcat
tcccctgtgaaggagggcagcctccggtcctcgcagggctgctcacaggcagagcccctt
ccaggcgcctcttcagcagctttcatccttccgactcctgcctctcccacgtcaccactc
accgacaccacggggcccccgtcaacctctcaggctgacaggactaccatgcccccagga
ctgcccgccctcagctctgccgagctcagcgtgcagagtactctgtctggaatgagcagc
ccagctccccatctttctgcgtctccacctcctgccatagcttctgcgaatcccacgtca
aaccccattttggggcccccacccaagagcgagattggaggctccttatattccagaact
tccgtcaccactacaacacctgcaactctgagcatcttcactccctccttcaagcctatc
tttggcggcgtaggaccactgaaaaccatgcccatgatagctcctttcaagcagacctct
cctctggctactcctgcttctacccatctcctccatggcctggtcaaggctacctctgtc
gtcgtgtccaccaccgcagccagcacatctaaagactcttctttcatgccgcctttggat
tttggtgtagtgaatgtgtccagtaccacggaaaacacttacaccatcccttcgacctgc
cacactttcctccttggggctgcctgtgccttcagggccagcttcgccccggccacaggc
ttcgttttcccaccacaccagcgtgctaccattcccaccgtacacacagtcaccatcttt
agccaggttctttccagcgctgtccagatctccccaagcaaaaccactgccaatttcagg
ggtgtgggcagtcctctgtcaacctcagccctggtaaccacacaccaggcctcattatca
tccagcatctccagtccaacctcagcattcgcagttcccttggggtcaggctcaaggcca
cccttcccactatccccaggagccactctccagctggcatttggggctacaggtgggcag
aagcaaggggccgtccaaccaacacttggcccaagcttcagtagccctttcatttttgga
aactcggccgtggcatccccaaccccaacgtccactccagctcagccagccttcagcagt
accacgcagtcaccctttgggggtttgacaccctcagcctccacgtgtcacctccctgct
ggcaccttgccgaattttggcagcactcccgcagggtttctctttggtcaagctagtaca
actggtttgagggttgtggcccagacccaccagaatggggcttgtggctcagtgtttggc
agcacagccccacgaccttttgcctttgggggattaatgacccctatggactgtggggac
tctgggatcggtgggactgccccagacatgagctccaaccctggagcgttcagcgttgga
acagtgccaagcgggaccactggcaccatgacaccctttggaaaaggctgtagccagaac
accccaggcctcaccaaccagagcacaccttctgtcttggggatggccggcatttctgca
agaaaaactatgtttggggccccctgcatgtccccctttgctcagagcacccttgtccct
gggccagtaacgacaagcagcagccttggctttgggatgccctctccacctccccagagt
tgtgctgggagaggacctttcacatcatcagcctcttcattttccattggtgcaaaatca
aaaaccccaaagaatcgggagcaagggcattcccgaaggcatcatgcccacaagaaatag

DBGET integrated database retrieval system