KEGG   Ailuropoda melanoleuca (giant panda): 100466624Help
Entry
100466624         CDS       T01329                                 

Definition
histone H2B 5-like
Orthology
K11252  
histone H2B
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:aml05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:aml05322]
Human Diseases; Substance dependence; Alcoholism [PATH:aml05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccggcaaaatccgctcccgcgcccaagaagggctcgaaaaaggctgtcacc
aaagcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagttactccatc
tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system