KEGG   Ailuropoda melanoleuca (giant panda): 100466687Help
Entry
100466687         CDS       T01329                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 2-like
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Steroid hormone biosynthesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100466687
 Human Diseases
  Cancers
   05215 Prostate cancer
    100466687
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100466687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 254 aa AA seqDB search
MTVPCQQSPVLAGSATLAALGALVLYLAKPSGYGKYSESLMPAATRLPARAAWFLQELPS
FAVPAGILAQHPRSLFGQPATVLLGLFCAHYFHRTFVYSLLTRGRPFPVVFLVRGFVFCT
GNGLLQGYYLIYCAEYPAEWYTDIRFTLGVFLFILGMGINIQSDYILRQLRKPGEVIYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLALRAFHHHRFYLKMFE
DYPKSRKALIPFIL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttccctgccagcagagcccggtgctggcaggcagcgccactttggccgccctg
ggggcgctggtcctgtacctcgcgaagccctccggctacgggaagtactcggagagcctg
atgcccgccgctacccgcctgcccgcccgcgccgcctggttcctgcaggagctgccctcc
ttcgcggtgcccgcggggatccttgcccagcatccacgctcgctcttcggccagcctgcg
acggtgctcctgggcctcttctgcgcacattacttccacaggacatttgtttactcattg
ctcactagagggaggcctttcccagttgtgttccttgtcagaggttttgtcttctgcacg
ggaaatggacttctccaaggctactatctgatttactgtgctgaataccctgctgagtgg
tacactgacatacggtttaccctgggtgtcttcttatttattttgggaatgggaatcaac
attcagagtgactatatattgcgccagctcaggaagcccggagaagtcatctataggatt
ccacaaggtggcttgtttacgtatgtttctggagccaatttccttggggagatcattgaa
tggatcggctatgccctggccacttggtccctcccagcacttgcattcgcgtttttctca
ctttgtttcctggcgctgcgagctttccaccatcatagattctacctcaagatgtttgag
gactaccccaaatctcggaaggccctcattccatttattctttaa

DBGET integrated database retrieval system