KEGG   Ailuropoda melanoleuca (giant panda): 100466871Help
Entry
100466871         CDS       T01329                                 

Gene name
PFN1
Definition
(RefSeq) profilin 1
  KO
K05759  
profilin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100466871 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100466871 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100466871 (PFN1)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100466871 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 101 aa AA seqDB search
MSSLGPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTF
NITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgctaggaccagctgaggttggtgtccttgttggcaaagaccggtcaagtttt
ttcgtgaacgggctgacacttgggggccagaaatgttctgttatccgggattcactgctg
caggacggggagtttaccatggatcttcgtaccaagagcaccggtggcgctcccactttc
aacatcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtc
cacggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccag
tactga

DBGET integrated database retrieval system