KEGG   Ailuropoda melanoleuca (giant panda): 100466871Help
Entry
100466871         CDS       T01329                                 

Definition
profilin-1-like
Orthology
K05759  
profilin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:aml04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:aml04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:aml05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 101 aa AA seqDB search
MSSLGPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTF
NITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgctaggaccagctgaggttggtgtccttgttggcaaagaccggtcaagtttt
ttcgtgaacgggctgacacttgggggccagaaatgttctgttatccgggattcactgctg
caggacggggagtttaccatggatcttcgtaccaagagcaccggtggcgctcccactttc
aacatcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtc
cacggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccag
tactga

DBGET integrated database retrieval system