KEGG   Ailuropoda melanoleuca (giant panda): 100466893Help
Entry
100466893         CDS       T01329                                 

Definition
glutamate receptor, ionotropic kainate 4-like
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100466893
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100466893
Ion channels [BR:aml04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100466893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 950 aa AA seqDB search
MPRVSAPLVLLPTWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFIKFQFQRFTTLNLHPSNTDISVAVAGVLNFFNCCAKAECLLNLEKLLRQFLISK
DTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAYYTYIFT
NLEFSLQRMDSLMDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTGPALSSA
LLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLTGHIEFN
SKGQRSNYALKILQFTRNGFRQIGQWHVADGLSMDSRLYASNISDSLFNTTLVVTTILEN
PYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTWTGMV
GELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPG
VWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGGFMQ
QGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQTAIE
YGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLLESTM
NEYYRQRDCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRKWWEG
GKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVSVCQEMV
TELRSIILCQDSAHPRRRRAGLPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQLAQRLA
QEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgccccgagtctcggcgcctttggtgctgcttcccacgtggctcgtgatggtcgcctgc
agccctcactccttgaggatcgctgctatcttggatgaccccatggagtgcagcagaggg
gagcggctctccatcaccctggccaagaaccgcatcaaccgcgctcctgagaggctgggc
aaggccaaggtcgaagtggacatctttgagcttctcagagacagcgagtacgagactgca
gaaaccatgtgtcagatcctccccaagggggtggtcgctgtcctgggaccctcctccagc
ccggcctccagctccatcatcagcaacatctgtggggagaaggaggtccctcatttcaaa
gtggcccccgaggagtttatcaagttccagttccagcgattcacaaccctgaacctccac
cccagcaacacggacatcagcgtggctgtcgctggggtcctgaacttcttcaactgctgt
gccaaagcagaatgccttttaaacctggagaagctgctccggcaattccttatctccaag
gacacactctcggtccggatgctggatgacacccgggaccccacccccctcctcaaggag
atccgggacgacaagaccgccaccatcatcatccacgccaacgcctccatgtcccacacc
atcctcctgaaggcagctgaactagggatggtgtcggcctattacacatacatcttcact
aatctggagttctcgctccagagaatggacagccttatggacgaccgtgtcaacatcctg
ggattttccatcttcaaccagtcacatgctttcttccaagagtttgcccagagcctcaac
cagtcgtggcaggagaactgtgaccacgtgcccttcacggggcctgcgctgtcctcggcc
ctgctgtttgacgccgtctatgctgtggtcaccgcggtgcaggagctcaaccggagccag
gagatcggcgtgaagcctctgtcctgtggctcggcccagatctggcagcacggcaccagc
ctcatgaattacctacgcatggtagaattggaaggtctcaccggccacattgaattcaac
agcaaaggccagaggtccaactatgccttgaaaatcttacagttcaccaggaatggtttt
cggcagattggccagtggcacgtggcggacgggctcagcatggacagccgcctctacgcc
tccaacatctccgacagtctcttcaacaccaccctggttgtcacaaccatcctggaaaac
ccgtatttaatgctgaaggggaaccaccaggagatggaaggcaacgaccgctacgagggc
ttctgtgtggacatgctcaaggagctggcagagatcctccggttcaactacaagatccgt
ctggttggggacggcgtgtacggtgtgcctgaggccaacggcacctggacgggaatggtc
ggggagctgatcgcgaggaaagcagacctggccgtggcaggcctcaccattactgccgag
cgggagaaggtgattgatttctccaagccattcatgactctgggaattagcattctttac
cgagttcatatgggacgcaaacctggctatttctccttcctggacccattttctccgggc
gtctggctcttcatgcttctagcctatctggctgtcagctgcgtcctcttcctagtggct
cggctgaccccctacgagtggtacagcccccacccgtgcgcccaaggccggtgcaacctg
ctggtgaaccagtactccctcggcaacagcctctggtttcccgttggaggcttcatgcag
cagggctccaccatcgccccccgagccttatccacccgctgtgtcagtggcgtctggtgg
gcattcacgctgatcatcatctcatcctacacggccaacctggcagccttcctgactgtg
cagcgcatggatgtgcccattgagtcagtggatgacctggctgaccagaccgccattgag
tatggcacaattcacggaggctccagcatgaccttcttccaaaactcccgctatcagacc
taccaacgcatgtggaattacatgtattctaagcagccaagtgtgtttgtgaagagcacc
gaggagggaatcgccagggtgttgaattccaactacgccttccttctggaatccaccatg
aatgagtactaccggcagcgagactgcaacctcactcagattgggggcctgctggacacc
aagggctatgggattggcatgccagtcggttcagttttccgggatgagtttgacctggcc
attctccagctgcaggagaacaaccgcctagaaattctgaagcgcaaatggtgggaaggc
ggcaagtgccccaaggaggaagatcacagagccaaaggtctgggaatggagaatattggt
ggaatctttgtggttcttatttgtggcttaatcgtggccatttttatggctatgttggag
tttttatggactctccgacactcggaagctactgaggtgtccgtctgccaggagatggtg
accgagctgcgcagcatcatcttatgtcaggacagtgcccacccccgccggcggcgcgcc
gggctgcctcctccccggcctcccatccccgaggagcgccggccacggggcacagccacc
ctcagcaacggcaagctgtgcggggccggggagcccgaccagctggcgcagagactggcc
caggaggccgccctggtggcccgcggctgcacgcacattcgcgtctgccccgagtgccgc
aggttccagggcctgcgggcacggccgtctccagcccgcagcgaggagagcctggagtgg
gagaagaccaccaacagcagcgagcccgagtag

DBGET integrated database retrieval system