KEGG   Ailuropoda melanoleuca (giant panda): 100466967Help
Entry
100466967         CDS       T01329                                 

Definition
cytochrome P450 1B1-like
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Ovarian steroidogenesis
Chemical carcinogenesis
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100466967
  Amino acid metabolism
   00380 Tryptophan metabolism
    100466967
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100466967
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100466967
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100466967
   05204 Chemical carcinogenesis
    100466967
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100466967
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP1 family
   100466967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 540 aa AA seqDB search
MATSLGPDAPLQPSALSSQQTTLLLLLSVLAAVHVGQWLLQQRRRQPGSAPPGPFAWPLI
GNAAAMGPAPHLSFARLARRYGDVFQIRLGNCPVVVLNGERAIRQALVQQGTAFADRPHF
ASFRWVSGGRSLAFGQYSQQWKVQRRAAQSTMRAFSXRQPRSRRVLEGHVLGEARELVAL
LVRGSAGGAFLDPRPLTVVAVANVMSAVCRYSHDDAEFRELLSHNEEFGRTVGAGSLVDV
LPWLQRFPNPVRTAFREFQQLNRDFSNFVLDKFLRHRESLQPGAGPRDMMDAFILSAGTD
AAEGSDDGGARLDLEYVPATVTDIFGASQDTLSTALQWLLVLFTRYPEVQARVQAELDRV
VGRARLPCLDDQPNLPYVMAFLYEAMRFSSFVPVTIPHATTTHASVLGYHIPKDTVVFVN
QWSVNHDPAKWPNPERFDPGRFLDKDGFIDKDVASGVMIFSVGKRRCIGEEISKMQLFLF
TSILAHQCNFKANPDEPSKMDFNYGLTIKPKSFRINVTLRESMELLDSAVQKLQAKEDCQ
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagcctcggtcccgacgctcccctgcagcccagtgcgctgtcgtcccagcag
accacgctcctgctgctcctttcggtgctggccgcggtgcacgtgggccagtggctgctg
cagcagcggcggcggcagccggggtctgcgccgccgggccctttcgcgtggccgctgatc
ggaaacgcggcggcgatgggcccagcgccgcacctctcgttcgcgcgcctggcgcggcgc
tacggcgacgtcttccagatccgtctgggcaactgccccgtggtggtgctgaacggcgag
cgcgccatccgccaggcgctggtgcagcagggcactgccttcgccgaccggccgcacttc
gcttcctttcgctgggtgtccggcggccgcagcctggctttcggccagtactcccagcag
tggaaggtgcagcggcgcgcggcgcagagcaccatgcgggccttctccnagcgccagccg
cgcagccggcgcgtcctcgagggccacgtgctgggcgaggcgcgggagctggtggcgctg
ctggtgcgcggtagcgcgggcggcgctttcctcgacccgcggccgctgaccgtggtggcc
gtggccaacgtcatgagcgccgtctgccgctacagccacgacgacgccgagttccgcgag
ctgctcagccacaacgaggagttcgggcgcacggtgggcgcgggcagcttggtggacgtg
ctgccctggctgcagcgcttccccaaccccgtgcgcaccgccttccgcgagttccagcag
ctcaaccgcgacttcagcaacttcgtcctcgacaagttcctgcggcaccgcgaaagcctg
cagcccggggccggcccccgcgacatgatggacgccttcatcctctcggcgggaacggac
gcggcggagggctcggacgacggcggcgcgcggctggacctggagtacgtgccggccact
gtcaccgatatcttcggcgccagccaggacacgctctccaccgcgctgcagtggctgctc
gtccttttcaccaggtaccctgaagtgcaggctcgggttcaggccgaactggacagggtc
gtgggtcgagcccggctcccctgcctggacgaccagcctaacctgccctatgtcatggcc
tttctgtatgaagccatgcgcttctccagctttgtgcccgtcaccattcctcatgccacc
accacccacgcctctgtcctgggctaccacattcccaaggacacagtggtttttgttaac
cagtggtctgtgaatcatgacccggcgaagtggcctaacccagagcgctttgatccgggc
cggttcttggacaaagacggcttcatcgacaaggacgtggccagcggcgtgatgattttt
tcagtgggcaaacggcggtgcatcggggaagagatttccaagatgcagctgtttctcttc
acttccatcctggctcaccagtgcaatttcaaggccaatccggacgaaccctcgaagatg
gattttaattacggtctgaccattaaacccaagtcatttagaatcaacgtcactctccga
gagtccatggagctcctcgacagcgctgtccagaagttacaagccaaggaagactgccag
tga

DBGET integrated database retrieval system