KEGG   Ailuropoda melanoleuca (giant panda): 100467094Help
Entry
100467094         CDS       T01329                                 

Definition
angiopoietin-2-like
Orthology
K05466  
angiopoietin 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100467094
   04015 Rap1 signaling pathway
    100467094
   04066 HIF-1 signaling pathway
    100467094
   04151 PI3K-Akt signaling pathway
    100467094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 495 aa AA seqDB search
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGRRQYQVQQGACSYTFLLPETDNCRSSSSYV
PNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKREMVELQQNAVQNQT
AVMIEIGTNLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEI
NKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNN
SVLQKQQHDLMETVHNLLTLISTSNSAKYSFDVKEEKVIFRDCAEVFKSGRTTNGIYTLT
FPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQKTWQEYKLGFGKPSGEHWLGNEFVF
QVTNQQPYMLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLNGLTGTAGKISSISQPGN
DFTTKDVDNDKCICKCSQMLSGGWWFDACGPSNLNGMYYPQKQNTNKFNGIKWYYWKGSG
YSLKATTMMIRPADF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattgttttctttactttgagctgtgatcttgtcctagccgcagcctataac
aactttcggaaaagcatggacagcatcgggagaaggcagtatcaggttcagcagggagcc
tgcagctacactttccttctgccggagacagacaactgtcgctcctctagctcctatgtg
cccaatgccgtgcagagggacgcaccactagattacgatgactcggtgcagaggctgcaa
gtgctggagaacatcatggaaaacaacactcagtggctaatgaagctcgagaattacatc
caggacaacatgaagagagaaatggtagagctgcaacagaacgcagtacagaaccagact
gcggtgatgatagagatagggacaaacctgctcaatcaaacagcagcgcagacacggaag
ttgacagacgttgaagcacaagtattaaatcagacaacaagacttgaacttcagcttctg
gaacattccctttccaccaacaaattggaaaaacagattttggatcagaccagtgaaatt
aacaaattgcaagataagaacagtttcctggaaaagaaagtactagacatggaagacaag
catatagttcaactacggtcaataaaagaagagaaagatcagctccaggtgttagtatcc
aagcaaaattccatcattgaagaactagaaaaacaactggtgaccgccacagtgaataat
tcggttctccaaaagcagcaacatgatctgatggagacagttcataatttattgaccctg
atatcaacgtcaaactcagccaagtactcctttgatgttaaggaagagaaagtcattttc
agagactgtgcggaagtattcaagtcaggacggacgaccaacggcatctacacgctcaca
ttccctaattccacagaggagatcaaggcatactgcgacatggaaacctctggaggcggg
tggacggtcattcagcggcgtgaagatggcagtgttgattttcagaagacttggcaagaa
tataaactgggatttgggaagccttccggcgaacactggctgggaaatgaatttgttttc
caagtgaccaatcaacagccctacatgcttaaaatacaccttaaagactgggaggggaac
gaggcgtactcactgtatgaacatttctatctctccggtgaagaactcaattacaggatt
caccttaacggacttacagggacggccggcaaaataagcagcataagccaaccaggaaat
gattttaccacaaaggatgtagacaacgacaaatgtatttgcaaatgttcacaaatgctc
tcaggaggctggtggtttgatgcgtgcggtccctccaacctgaacggaatgtactaccca
cagaagcagaacacaaacaagttcaacggcattaagtggtactactggaaaggctcaggc
tactcgctcaaggccacgaccatgatgatccgaccagcagatttctag

DBGET integrated database retrieval system