KEGG   Ailuropoda melanoleuca (giant panda): 100467417Help
Entry
100467417         CDS       T01329                                 

Gene name
CLTCL1
Definition
clathrin, heavy chain-like 1
Orthology
K04646  
clathrin heavy chain
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:aml04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aml04142]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:aml04961]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:aml04721]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:aml05016]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:aml05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1676 aa AA seqDB search
METEDLPKRPLSVVLGALQNLGINPANIGFSTLTMESDKFICVREKVGEQAQVVIIDMSD
PMAPIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKSHTMAEEVIFWKWVSVN
TVALVTETTVYHWSMEGDSQPVKMFDRHASLAGCQMIHYRTDEYQKWLLLIGISAQQNRV
VGAMQLYSVDRKVSQPIEGHAAAFAEFKSEGNAKPATLFCFAVRSPTGGKLHIIEVGQPA
AGNQPFVKKAVDVFFPPEAQTDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCIYMNR
ISADTIFVTAPHEPTSGIIGVNKKGQVLSICVEEDNVVNYATNVLQNPDLGLRLAIRSNL
AGAEELFVRKFSTLFAQGSYAEAAKVAASAPKGVLRTSDTVRKFQSIPAQPGQASPLLQY
FGILLDQGQLNKLESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKTADPTLALS
VYLRANVPSKVIQCFAETGQFQKIVLYAKKVGYVPDWIFLLRSVMRISPDQGLQFSQMLV
REEEPLANIDQIVDVFMENSLIQQCTSFLLDALKNNLPAEGHLQTRLLEMNLIHAPQVAD
AILGNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVSFFGS
LSVEDSLACLHALLSASIRQNLQLCVQVASKYHEQLGTQSLVELFESFKSYEGLFYFLGS
IVNFSQDPDVHLKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIV
CDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRIPAVVGGLLDVDCSEEVIKNLIMVVR
GQFSTDELVAEVEKRNRLKLLLPWLESRSHEGCEEPATHNALAKIYIDSNNSPERFLREN
AYYDSRVVGRYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVHRKDPELWA
HVLEETNPARRQLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSV
FSEHRNLQNLLILTAIKADRTRVMDYISRLDNYDAPDIANIAVSSALYEEAFAIFRKFDV
NASAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLARAQLQKDLVKEAIDSYIRADDPSSY
LEVVQAASRSNNWEDLVKFLQMARKKGRESYIETELIFALAKTGRLSELEDCINGPNNAH
IQQVGDRCYEEGMYEAAKLLYSSVSNFARLASTLVHLGEYQAAVDSSRKANSTRTWKEVC
FACVDGQEFRLAQLCGLHIVIHADELEELIRYYQDRGYFEDLISLLEAALGLERAHMGMF
TELAILYSKFKPQKMPEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLT
MINHPTDAWREGQFKDVIAKVANVELYYKALQFYLDYKPLLINDLLLVLAPRLDHTRTVG
FFSKAGQLPLVKPYLRSVQSHNNKSVNEALNQLLTEEEDYQGLRASIDAYDNFDNIALAQ
RLEKHQLIEFRRIAAYLYKGNNRWAQSVELCKKDRLYKDAMQHAAESRDAELAEKLLQWF
LEEGKRECFAASLFTCYDLLPPDVVLELAWRHNLVDLAMPYFIQVMREYLNKVDRLDASE
SLRKREEHVVEPAPLLFGQQLMVTAGPASGPAPAGFPYGYAAAPAFAQPPVYGFSV
NT seq 5031 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccgaagatctgccgaaacgtcccctttcagtggttttgggagctctccaaaac
ctgggaattaatccagccaacattgggttcagcacactgaccatggaatctgataagttt
atatgtgtccgagagaaggttggcgaacaggcgcaggtagtgattattgacatgagcgat
ccaatggcgcccatcaggcggcccatctctgctgaaagtgccatcatgaatccagcctct
aaagtgatagctctgaaagctgggaagacacttcagatctttaatattgaaatgaagagt
aaaatgaagtctcatacaatggcagaagaggtgattttctggaagtgggtctctgtgaac
actgttgccctggtgactgagaccacagtctaccactggagcatggaaggtgactctcaa
cccgtgaagatgtttgatagacatgccagtctggcagggtgccaaatgatccattaccgg
actgacgagtaccagaagtggctgctcctcattggcatctcagctcagcaaaaccgtgta
gttggggcaatgcagctctactctgtggataggaaggtttcacaacccatagaaggccat
gctgctgcttttgcagagttcaagagtgaggggaatgccaagcctgccacccttttctgc
tttgctgtacgtagtcccacagggggcaagttgcacataattgaagtcggacagcctgca
gcaggaaaccaaccttttgtaaagaaagctgtggatgtgtttttccctccagaggctcag
actgatttcccagtggctatgcagattggagccaaacatggtgttatttacttgatcaca
aagtatggctatcttcatctgtatgacctagagtctggcgtgtgcatctacatgaaccgt
attagtgctgacacgatttttgtcactgctccacatgaacctacttctggaattatcggt
gtcaacaaaaagggacaggtgctgtccatttgtgtcgaggaagataacgttgtgaattac
gcaaccaatgtgcttcagaatccagaccttggtctgcgtttggccattcgtagcaacctg
gctggggcggaggagttatttgtgagaaaattcagtaccctctttgcgcaggggagctat
gctgaagccgccaaagtagcagcatctgcaccaaagggagtcctacgtaccagtgacaca
gttcggaagttccagagtattcccgcccagcctgggcaggcctctcctttgctccagtac
tttggaatcctgcttgaccagggtcagctcaataaacttgaatccttagaactttgccgt
ccagtgcttcagcagggacgcaagcaactcttagaaaagtggctgaaagaagataagctg
gagtgttcagaagaacttggagatttggtcaaaactgctgaccccacacttgctctgagt
gtgtatcttcgggcgaatgtgccaagcaaagttatccagtgttttgcagaaacaggccaa
ttccagaaaattgtcctctatgccaaaaaggttggctatgtcccagactggatctttctg
ctgaggagtgtgatgaggatcagcccagaccagggcctgcagttttctcaaatgctagtg
cgagaggaagagccattggccaacattgaccagattgtagatgttttcatggaaaacagt
ttaattcagcagtgtacttccttcttgttggatgccttgaaaaataatctcccagctgag
gggcacctccagactcgcctgttggagatgaacctgattcatgcaccccaggttgcagat
gccattcttggaaatcagatgtttactcattatgatcgggcacacattgcccagctctgt
gaaaaggcaggcctcctgcagcgtgcactggagcactacactgacctctacgacatcaag
agggctgtggtccacactcacctcctcaatcccgagtggctcgtcagcttctttggctcc
ttgtcagtggaggattctttggcgtgtcttcatgctctgctgtctgccagcatcagacag
aaccttcagctgtgtgtgcaggtggcctccaagtaccacgagcaactgggcacacagtcc
ctggtggagctctttgaatccttcaagagttatgaaggcctcttctacttcctcggctct
attgtaaacttcagccaagatccagacgtgcacttgaagtacattcaggctgcctgtaag
acggggcagatcaaggaggtggagaggatatgccgggagagtaattgctacaacccagaa
cgggtgaagaactttctgaaggaggccaagctcacagaccagcttcccctcatcattgtg
tgtgatcggtttgactttgtccatgacctcgtcctgtacttgtaccgcaacaacctgcag
aagtacatcgagatctacgttcagaaggtcaaccctagccggatccctgctgtggttgga
gggctgcttgatgtggattgttctgaggaagtaattaaaaacttaatcatggtggtgaga
ggacagttctctactgatgagctggtggctgaagtagaaaaaagaaacaggctaaagctg
ctgcttccctggctggagtcccggagccacgaaggctgtgaagagcctgccactcacaat
gcacttgccaagatctacattgacagcaacaatagccccgagcgcttcctgagagagaac
gcttactacgacagccgcgtggtgggccgctactgtgagaagcgggacccacatctggcc
tgtgtcgcctatgagcggggccagtgtgaccttgagctcatcaaggtttgcaacgagaat
tctctgttcaaaagtgaggcccgctacctggtgcacaggaaggatccagagctctgggct
cacgtccttgaggagaccaacccagccaggagacagctgatcgaccaggtggtacagact
gcattgtcagaaacacaggatcctgaagaggtctcagtcaccgtcaaggccttcatgaca
gctgatctgcctaatgaactgattgagctgctggagaagattgttctggataactcggtt
ttcagtgagcacaggaatctccagaatctgctgatcctgaccgccatcaaggcggaccgc
acgcgggtcatggactacatcagccgcctggacaactacgatgccccagacattgcaaac
atcgccgtcagcagcgcactgtatgaggaggccttcgccatcttccgcaagtttgatgtg
aatgcctcagcagtccaggtcctgatcgagcacattggaaacctagatcgagcatatgag
tttgcagagagatgcaatgagcctgctgtgtggagccagctggcccgcgcccagctccag
aaagacttggtgaaagaagccatcgactcctacattagagctgatgacccttcctcttac
ctggaggtcgttcaggcagccagcaggagcaacaattgggaggatctggttaaatttcta
cagatggccaggaaaaagggccgcgaatcctatatagagactgaacttatttttgccctg
gctaaaactggccgtctgtctgagctagaagattgtattaatggacccaacaatgcccac
atccagcaggttggagaccgctgttacgaagagggaatgtatgaggccgccaagctgctg
tacagcagtgtttctaactttgcccgcctggcttccaccctggtccacctcggggaatat
caggcagcagtggacagcagccgcaaggccaacagcacccggacatggaaggaggtgtgc
tttgcatgtgtggatgggcaggagttccgccttgcacagctgtgtggtcttcacattgtc
attcatgcagatgagctggaggagctgatacgctattaccaggataggggctactttgag
gacttgatctctctcctggaggcggccctgggcctggagcgggcccacatgggcatgttc
acagaactggccatcctctactccaaattcaagcctcagaagatgccagagcacctggaa
ctcttctggtcccgagtcaacatcccaaaggtgctgagagctgcagagcaggcgcacctc
tgggcggagctggtgttcctctatgacaagtacgaagagtacgacaatgccgtcctcacc
atgatcaatcaccctactgacgcctggagggaagggcagttcaaggatgtcattgccaag
gttgccaatgtggagctctactataaagccctgcagttctatttggattacaaacctctg
ctcatcaacgacctgttgcttgtgctggcgccccggctagaccacacccgcactgttggc
ttcttttcaaaggcaggccagttgcccctagtgaagccttacctgcggtcagtccagagc
cacaacaacaagagtgtgaatgaggccctcaaccagctactgacggaagaggaggattac
cagggtttgagggcgtctatcgatgcctacgacaactttgacaacatcgccctggcacag
cggttggagaagcaccagctgattgagttcaggcgcattgcggcttatctatacaagggc
aacaaccggtgggcccagagcgtggagctctgcaagaaggaccgtctctacaaggacgcc
atgcagcatgctgcagagtccagggatgctgagctggccgagaagttgcttcagtggttc
ctggaagagggcaagcgggagtgctttgcagcctctctcttcacctgctacgacctgctt
cccccggatgtggtgctggagctggcctggagacacaaccttgtggacctggccatgccc
tacttcatccaggtgatgagggagtaccttaacaaagtagacagattggacgcttcggag
agcctgcgcaagcgagaggagcatgtggtggagcccgcccctctcctgttcggccagcag
ctgatggtgacagcaggccctgcttcgggccctgcccctgctggattcccctatggatat
gctgctgcacctgccttcgcccagcctcctgtgtacggcttcagcgtgtag

DBGET integrated database retrieval system