KEGG   Ailuropoda melanoleuca (giant panda): 100467417Help
Entry
100467417         CDS       T01329                                 

Gene name
CLTCL1
Definition
(RefSeq) clathrin, heavy chain-like 1
  KO
K04646  
clathrin heavy chain
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100467417 (CLTCL1)
   04142 Lysosome
    100467417 (CLTCL1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100467417 (CLTCL1)
  Nervous system
   04721 Synaptic vesicle cycle
    100467417 (CLTCL1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100467417 (CLTCL1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100467417 (CLTCL1)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100467417 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1642 aa AA seqDB search
MESDKFICVREKVGEQAQVVIIDMSDPMAPIRRPISAESAIMNPASKVIALKAGKTLQIF
NIEMKSKMKSHTMAEEVIFWKWVSVNTVALVTETTVYHWSMEGDSQPVKMFDRHASLAGC
QMIHYRTDEYQKWLLLIGISAQQNRVVGAMQLYSVDRKVSQPIEGHAAAFAEFKSEGNAK
PATLFCFAVRSPTGGKLHIIEVGQPAAGNQPFVKKAVDVFFPPEAQTDFPVAMQIGAKHG
VIYLITKYGYLHLYDLESGVCIYMNRISADTIFVTAPHEPTSGIIGVNKKGQVLSICVEE
DNVVNYATNVLQNPDLGLRLAIRSNLAGAEELFVRKFSTLFAQGSYAEAAKVAASAPKGV
LRTSDTVRKFQSIPAQPGQASPLLQYFGILLDQGQLNKLESLELCRPVLQQGRKQLLEKW
LKEDKLECSEELGDLVKTADPTLALSVYLRANVPSKVIQCFAETGQFQKIVLYAKKVGYV
PDWIFLLRSVMRISPDQGLQFSQMLVREEEPLANIDQIVDVFMENSLIQQCTSFLLDALK
NNLPAEGHLQTRLLEMNLIHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHYT
DLYDIKRAVVHTHLLNPEWLVSFFGSLSVEDSLACLHALLSASIRQNLQLCVQVASKYHE
QLGTQSLVELFESFKSYEGLFYFLGSIVNFSQDPDVHLKYIQAACKTGQIKEVERICRES
NCYNPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSR
IPAVVGGLLDVDCSEEVIKNLIMVVRGQFSTDELVAEVEKRNRLKLLLPWLESRSHEGCE
EPATHNALAKIYIDSNNSPERFLRENAYYDSRVVGRYCEKRDPHLACVAYERGQCDLELI
KVCNENSLFKSEARYLVHRKDPELWAHVLEETNPARRQLIDQVVQTALSETQDPEEVSVT
VKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMDYISRLDNYD
APDIANIAVSSALYEEAFAIFRKFDVNASAVQVLIEHIGNLDRAYEFAERCNEPAVWSQL
ARAQLQKDLVKEAIDSYIRADDPSSYLEVVQAASRSNNWEDLVKFLQMARKKGRESYIET
ELIFALAKTGRLSELEDCINGPNNAHIQQVGDRCYEEGMYEAAKLLYSSVSNFARLASTL
VHLGEYQAAVDSSRKANSTRTWKEVCFACVDGQEFRLAQLCGLHIVIHADELEELIRYYQ
DRGYFEDLISLLEAALGLERAHMGMFTELAILYSKFKPQKMPEHLELFWSRVNIPKVLRA
AEQAHLWAELVFLYDKYEEYDNAVLTMINHPTDAWREGQFKDVIAKVANVELYYKALQFY
LDYKPLLINDLLLVLAPRLDHTRTVGFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNQLL
TEEEDYQGLRASIDAYDNFDNIALAQRLEKHQLIEFRRIAAYLYKGNNRWAQSVELCKKD
RLYKDAMQHAAESRDAELAEKLLQWFLEEGKRECFAASLFTCYDLLPPDVVLELAWRHNL
VDLAMPYFIQVMREYLNKVDRLDASESLRKREEHVVEPAPLLFGQQLMVTAGPASGPAPA
GFPYGYAAAPAFAQPPVYGFSV
NT seq 4929 nt NT seq  +upstreamnt  +downstreamnt
atggaatctgataagtttatatgtgtccgagagaaggttggcgaacaggcgcaggtagtg
attattgacatgagcgatccaatggcgcccatcaggcggcccatctctgctgaaagtgcc
atcatgaatccagcctctaaagtgatagctctgaaagctgggaagacacttcagatcttt
aatattgaaatgaagagtaaaatgaagtctcatacaatggcagaagaggtgattttctgg
aagtgggtctctgtgaacactgttgccctggtgactgagaccacagtctaccactggagc
atggaaggtgactctcaacccgtgaagatgtttgatagacatgccagtctggcagggtgc
caaatgatccattaccggactgacgagtaccagaagtggctgctcctcattggcatctca
gctcagcaaaaccgtgtagttggggcaatgcagctctactctgtggataggaaggtttca
caacccatagaaggccatgctgctgcttttgcagagttcaagagtgaggggaatgccaag
cctgccacccttttctgctttgctgtacgtagtcccacagggggcaagttgcacataatt
gaagtcggacagcctgcagcaggaaaccaaccttttgtaaagaaagctgtggatgtgttt
ttccctccagaggctcagactgatttcccagtggctatgcagattggagccaaacatggt
gttatttacttgatcacaaagtatggctatcttcatctgtatgacctagagtctggcgtg
tgcatctacatgaaccgtattagtgctgacacgatttttgtcactgctccacatgaacct
acttctggaattatcggtgtcaacaaaaagggacaggtgctgtccatttgtgtcgaggaa
gataacgttgtgaattacgcaaccaatgtgcttcagaatccagaccttggtctgcgtttg
gccattcgtagcaacctggctggggcggaggagttatttgtgagaaaattcagtaccctc
tttgcgcaggggagctatgctgaagccgccaaagtagcagcatctgcaccaaagggagtc
ctacgtaccagtgacacagttcggaagttccagagtattcccgcccagcctgggcaggcc
tctcctttgctccagtactttggaatcctgcttgaccagggtcagctcaataaacttgaa
tccttagaactttgccgtccagtgcttcagcagggacgcaagcaactcttagaaaagtgg
ctgaaagaagataagctggagtgttcagaagaacttggagatttggtcaaaactgctgac
cccacacttgctctgagtgtgtatcttcgggcgaatgtgccaagcaaagttatccagtgt
tttgcagaaacaggccaattccagaaaattgtcctctatgccaaaaaggttggctatgtc
ccagactggatctttctgctgaggagtgtgatgaggatcagcccagaccagggcctgcag
ttttctcaaatgctagtgcgagaggaagagccattggccaacattgaccagattgtagat
gttttcatggaaaacagtttaattcagcagtgtacttccttcttgttggatgccttgaaa
aataatctcccagctgaggggcacctccagactcgcctgttggagatgaacctgattcat
gcaccccaggttgcagatgccattcttggaaatcagatgtttactcattatgatcgggca
cacattgcccagctctgtgaaaaggcaggcctcctgcagcgtgcactggagcactacact
gacctctacgacatcaagagggctgtggtccacactcacctcctcaatcccgagtggctc
gtcagcttctttggctccttgtcagtggaggattctttggcgtgtcttcatgctctgctg
tctgccagcatcagacagaaccttcagctgtgtgtgcaggtggcctccaagtaccacgag
caactgggcacacagtccctggtggagctctttgaatccttcaagagttatgaaggcctc
ttctacttcctcggctctattgtaaacttcagccaagatccagacgtgcacttgaagtac
attcaggctgcctgtaagacggggcagatcaaggaggtggagaggatatgccgggagagt
aattgctacaacccagaacgggtgaagaactttctgaaggaggccaagctcacagaccag
cttcccctcatcattgtgtgtgatcggtttgactttgtccatgacctcgtcctgtacttg
taccgcaacaacctgcagaagtacatcgagatctacgttcagaaggtcaaccctagccgg
atccctgctgtggttggagggctgcttgatgtggattgttctgaggaagtaattaaaaac
ttaatcatggtggtgagaggacagttctctactgatgagctggtggctgaagtagaaaaa
agaaacaggctaaagctgctgcttccctggctggagtcccggagccacgaaggctgtgaa
gagcctgccactcacaatgcacttgccaagatctacattgacagcaacaatagccccgag
cgcttcctgagagagaacgcttactacgacagccgcgtggtgggccgctactgtgagaag
cgggacccacatctggcctgtgtcgcctatgagcggggccagtgtgaccttgagctcatc
aaggtttgcaacgagaattctctgttcaaaagtgaggcccgctacctggtgcacaggaag
gatccagagctctgggctcacgtccttgaggagaccaacccagccaggagacagctgatc
gaccaggtggtacagactgcattgtcagaaacacaggatcctgaagaggtctcagtcacc
gtcaaggccttcatgacagctgatctgcctaatgaactgattgagctgctggagaagatt
gttctggataactcggttttcagtgagcacaggaatctccagaatctgctgatcctgacc
gccatcaaggcggaccgcacgcgggtcatggactacatcagccgcctggacaactacgat
gccccagacattgcaaacatcgccgtcagcagcgcactgtatgaggaggccttcgccatc
ttccgcaagtttgatgtgaatgcctcagcagtccaggtcctgatcgagcacattggaaac
ctagatcgagcatatgagtttgcagagagatgcaatgagcctgctgtgtggagccagctg
gcccgcgcccagctccagaaagacttggtgaaagaagccatcgactcctacattagagct
gatgacccttcctcttacctggaggtcgttcaggcagccagcaggagcaacaattgggag
gatctggttaaatttctacagatggccaggaaaaagggccgcgaatcctatatagagact
gaacttatttttgccctggctaaaactggccgtctgtctgagctagaagattgtattaat
ggacccaacaatgcccacatccagcaggttggagaccgctgttacgaagagggaatgtat
gaggccgccaagctgctgtacagcagtgtttctaactttgcccgcctggcttccaccctg
gtccacctcggggaatatcaggcagcagtggacagcagccgcaaggccaacagcacccgg
acatggaaggaggtgtgctttgcatgtgtggatgggcaggagttccgccttgcacagctg
tgtggtcttcacattgtcattcatgcagatgagctggaggagctgatacgctattaccag
gataggggctactttgaggacttgatctctctcctggaggcggccctgggcctggagcgg
gcccacatgggcatgttcacagaactggccatcctctactccaaattcaagcctcagaag
atgccagagcacctggaactcttctggtcccgagtcaacatcccaaaggtgctgagagct
gcagagcaggcgcacctctgggcggagctggtgttcctctatgacaagtacgaagagtac
gacaatgccgtcctcaccatgatcaatcaccctactgacgcctggagggaagggcagttc
aaggatgtcattgccaaggttgccaatgtggagctctactataaagccctgcagttctat
ttggattacaaacctctgctcatcaacgacctgttgcttgtgctggcgccccggctagac
cacacccgcactgttggcttcttttcaaaggcaggccagttgcccctagtgaagccttac
ctgcggtcagtccagagccacaacaacaagagtgtgaatgaggccctcaaccagctactg
acggaagaggaggattaccagggtttgagggcgtctatcgatgcctacgacaactttgac
aacatcgccctggcacagcggttggagaagcaccagctgattgagttcaggcgcattgcg
gcttatctatacaagggcaacaaccggtgggcccagagcgtggagctctgcaagaaggac
cgtctctacaaggacgccatgcagcatgctgcagagtccagggatgctgagctggccgag
aagttgcttcagtggttcctggaagagggcaagcgggagtgctttgcagcctctctcttc
acctgctacgacctgcttcccccggatgtggtgctggagctggcctggagacacaacctt
gtggacctggccatgccctacttcatccaggtgatgagggagtaccttaacaaagtagac
agattggacgcttcggagagcctgcgcaagcgagaggagcatgtggtggagcccgcccct
ctcctgttcggccagcagctgatggtgacagcaggccctgcttcgggccctgcccctgct
ggattcccctatggatatgctgctgcacctgccttcgcccagcctcctgtgtacggcttc
agcgtgtag

DBGET integrated database retrieval system