KEGG   Ailuropoda melanoleuca (giant panda): 100467420Help
Entry
100467420         CDS       T01329                                 

Gene name
CDKN2D
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
  KO
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100467420 (CDKN2D)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100467420 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPTIALEL
LKQGASPNVQDTTGTTPAHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVREGHT
AVVSFLATESDLHHRDARGLTPLELAQGIGAQDLMDILQGHAVVLL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggtccgcgccggcgaccggctaagcggggccgcggcccgaggcgac
gtgcaggaggtgcgccgccttctgcaccgcgagctggtgcaccctgacgccctgaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggcagccccaccattgccttggagctc
ctcaaacaaggtgccagccccaatgtccaggacaccaccggcactactccagcccatgat
gcagcgcgcactggattcctggacaccctgaaggttttggttgagcacggtgctgatgtc
aacgtgcctgatggcactggggcgctccctatccatctggcagtacgagagggccacacg
gctgtggtcagcttcctggctaccgagtctgatctccatcacagggacgccaggggactc
acacccctggagttggcccaggggataggggctcaggatctcatggacatactgcagggg
cacgcggtggtactgctgtga

DBGET integrated database retrieval system