KEGG   Ailuropoda melanoleuca (giant panda): 100467420Help
Entry
100467420         CDS       T01329                                 

Definition
cyclin-dependent kinase 4 inhibitor D-like
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
FoxO signaling pathway
Cell cycle
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aml04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:aml04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPTIALEL
LKQGASPNVQDTTGTTPAHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVREGHT
AVVSFLATESDLHHRDARGLTPLELAQGIGAQDLMDILQGHAVVLL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggtccgcgccggcgaccggctaagcggggccgcggcccgaggcgac
gtgcaggaggtgcgccgccttctgcaccgcgagctggtgcaccctgacgccctgaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggcagccccaccattgccttggagctc
ctcaaacaaggtgccagccccaatgtccaggacaccaccggcactactccagcccatgat
gcagcgcgcactggattcctggacaccctgaaggttttggttgagcacggtgctgatgtc
aacgtgcctgatggcactggggcgctccctatccatctggcagtacgagagggccacacg
gctgtggtcagcttcctggctaccgagtctgatctccatcacagggacgccaggggactc
acacccctggagttggcccaggggataggggctcaggatctcatggacatactgcagggg
cacgcggtggtactgctgtga

DBGET integrated database retrieval system