KEGG   Ailuropoda melanoleuca (giant panda): 100467465Help
Entry
100467465         CDS       T01329                                 

Definition
uncharacterized LOC100467465
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100467465
Translation factors [BR:aml03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100467465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 544 aa AA seqDB search
MYWPQGAHRKGKCSSFGALFDPFVTNSRQTCQELNSSTLAGKAAKNAALSTRSFPGAGPT
LASRESSPPPARATPPSEGRAPPRPLGGPGVHSPLQSAAWKVWGSPWYPPTAPSGDLKEQ
REGAPDPAGRGAAGLGLGLGLAGEGWRGQARAKRQSRGRPSKFLALNDSSRSPDWGSRVP
XXXXXPPTTPRPLPPRRVVFYTRSHPPAPQPRRRPHSTPPSRLRARRPATASREGGAWVA
AHSQPRSQPAPRRPTRAKPVTHLRRANSALARPSHTLXXXXXRRRRRRRRRGTLIPGVRR
NADTFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKVSEK
KKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKE
TFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEID
DLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDY
EDFM
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtactggcctcaaggggctcacaggaagggaaaatgctcgagttttggggctctcttc
gatcccttcgtgactaactcgaggcaaacgtgccaggagctgaattcgagcaccctggct
gggaaggcggccaagaatgcggccctgtccactcgctccttcccgggcgccgggcccacg
ctggcttccagagagagctccccgccgccagcgcgcgcgacgcccccgtccgaaggtcgg
gcccccccccgccccctcggcgggcctggcgttcacagcccgcttcagagcgcagcttgg
aaagtttgggggtctccttggtatccgccaacagccccgagcggcgacctaaaagaacag
agggagggcgcacccgacccggcggggcggggcgcggcggggctgggcttggggttgggg
ttggctggggagggctggcgaggacaggcgagggccaagcgccagtcaaggggccgccct
tctaaattcctcgcacttaacgattcctcccggagcccagactggggcagccgtgtcccg
nnnnnnnnnnnnnnnccccccacaaccccaagaccactacctccacgccgtgtagtattt
tacactcggtctcaccctcccgccccacaaccgcgccggcggccgcattccacgccccct
tctcgcctgcgcgcgcgacgccctgccaccgcctccagagagggcggggcttgggtcgcg
gcgcacagtcagccacggtcccagcctgccccgcgccggccaacgagagcaaagccagtg
actcacctccgccgcgctaactccgcgcttgctcgcccctcacacacgctcannnnnnnn
nnnnnnagacggcggcggcggcggcggcggcgggggactctgattcctggggtgaggaga
aacgcggacacgttctccgtggaagacccggtgcggaaggtggggggcggcggcaccgcc
ggcggggaccgctgggaaggcgaggacgaggacgaggacgtcaaggataactgggatgat
gatgatgatgaaaaaaaagaggaagcagaagtaaagccagaagtaaaagtttcagaaaag
aaaaaaatagcagagaaaataaaagagaaagaacggcaacagaagaaaaggcaagaagaa
attaaaaagaggttagaagaacctgaggaacctaaagtgctaacaccagaagaacaatta
gcagataaactgcggctaaagaaattacaggaagaatcagaccttgaattagcaaaagaa
acctttggtgttaataatacagtttatggaatagatgctatgaacccatcttcaagagat
gacttcacagagtttggaaagttactaaaagataaaattacacaatatgaaaagtcacta
tattatgccagttttttggaagccttagttcgagatgtgtgtatttcattggaaattgat
gacttgaaaaagattaccaattcattgactgtgctttgcagtgaaaaacaaaagcaagaa
aagcaaagcaaagccaaaaagaagaagaaaggtgtggtccctggagggggactaaaggct
accatgaaagacgatctggcagattatggtggctatgacggcggatacgtacaagactat
gaagacttcatgtga

DBGET integrated database retrieval system