KEGG   Ailuropoda melanoleuca (giant panda): 100467465Help
Entry
100467465         CDS       T01329                                 

Gene name
EIF3J
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit J
  KO
K03245  
translation initiation factor 3 subunit J
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100467465 (EIF3J)
Translation factors [BR:aml03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100467465 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 436 aa AA seqDB search
MYWPQGAHRKGKCSSFGALFDPFVTNSRQTCQELNSSTLAGKAAKNAALSTRSFPGAGPT
LASRESSPPPARATPPSEGRAPPRPLGGPGVHSPLQSAAWKVWGSPWYPPTAPSGDLKEQ
REGAPDPAGRGAAGLGLGLGLAGEGWRGQARAKRQSRGRPSKFLALNDSSRSPDWGSRTA
AAAAAAGDSDSWDADTFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEE
AEVKPEVKVSEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKK
LQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEA
LVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLAD
YGGYDGGYVQDYEDFM
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtactggcctcaaggggctcacaggaagggaaaatgctcgagttttggggctctcttc
gatcccttcgtgactaactcgaggcaaacgtgccaggagctgaattcgagcaccctggct
gggaaggcggccaagaatgcggccctgtccactcgctccttcccgggcgccgggcccacg
ctggcttccagagagagctccccgccgccagcgcgcgcgacgcccccgtccgaaggtcgg
gcccccccccgccccctcggcgggcctggcgttcacagcccgcttcagagcgcagcttgg
aaagtttgggggtctccttggtatccgccaacagccccgagcggcgacctaaaagaacag
agggagggcgcacccgacccggcggggcggggcgcggcggggctgggcttggggttgggg
ttggctggggagggctggcgaggacaggcgagggccaagcgccagtcaaggggccgccct
tctaaattcctcgcacttaacgattcctcccggagcccagactggggcagccgtacggcg
gcggcggcggcggcggcgggggactctgattcctgggacgcggacacgttctccgtggaa
gacccggtgcggaaggtggggggcggcggcaccgccggcggggaccgctgggaaggcgag
gacgaggacgaggacgtcaaggataactgggatgatgatgatgatgaaaaaaaagaggaa
gcagaagtaaagccagaagtaaaagtttcagaaaagaaaaaaatagcagagaaaataaaa
gagaaagaacggcaacagaagaaaaggcaagaagaaattaaaaagaggttagaagaacct
gaggaacctaaagtgctaacaccagaagaacaattagcagataaactgcggctaaagaaa
ttacaggaagaatcagaccttgaattagcaaaagaaacctttggtgttaataatacagtt
tatggaatagatgctatgaacccatcttcaagagatgacttcacagagtttggaaagtta
ctaaaagataaaattacacaatatgaaaagtcactatattatgccagttttttggaagcc
ttagttcgagatgtgtgtatttcattggaaattgatgacttgaaaaagattaccaattca
ttgactgtgctttgcagtgaaaaacaaaagcaagaaaagcaaagcaaagccaaaaagaag
aagaaaggtgtggtccctggagggggactaaaggctaccatgaaagacgatctggcagat
tatggtggctatgacggcggatacgtacaagactatgaagacttcatgtga

DBGET integrated database retrieval system