KEGG   Ailuropoda melanoleuca (giant panda): 100467467Help
Entry
100467467         CDS       T01329                                 

Gene name
CYLD
Definition
(RefSeq) cylindromatosis (turban tumor syndrome)
  KO
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100467467 (CYLD)
  Development
   04380 Osteoclast differentiation
    100467467 (CYLD)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100467467 (CYLD)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C67
   100467467 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 953 aa AA seqDB search
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGI
YQGKQLFQCDEDCGVFVALDKLEILEDDDNGLESDFAGPGDTMQMELPPLEINSRVSLKL
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPDSVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSEFFYTLNGSSV
DSQPQSKSKNTWYIDEVAEDPAKSLTEIAPDFGHASPPLQPPSMNSLSTENRFHSLPFSL
TKMPNTNGSIGHSPLSLSVQSVMGELNNAPVQESPPLAVTSGNSHGLEVGSLAEVKENPP
FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDS
RFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYL
DSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLR
KILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNE
KVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLED
TPRQCRICGGLAMYECRECYDDPDISAGNIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKD
LPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNI
PQVTPCPEVGEYLKMSPEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagaaaaagttacttcaccctactgggaagagcggatt
ttttatttgcttcttcaagaatgcagtgttacagacaaacaaacacaaaagctccttaaa
gtaccaaaggggagtataggacagtatatccaagatcgttctgtggggcactcaaggatt
ccttctgcaaaaggcaagaaaaatcagattggattaaaaattttagagcaaccacatgca
gttctctttgttgatgaaaaggatgttgtagaaataaatgaaaagttcacagagttgctt
ttggcaattaccaattgtgaagagaggttcagcctgtttaagaacagaaacagactaagt
aaaggcctccagatagatgtgggctgccctgtgaaagtacagctgagatctggggaagaa
aaatttcctggagttgtgcgcttcagaggacccttattagcagagaggacagtgtcggga
atattctttggagtagaattactggaagaaggtcgtggccaaggtttcactgatggaata
tatcaagggaaacagctttttcagtgtgatgaagactgtggagtatttgttgcgttggac
aagctagaaatcctagaagatgatgacaatggattggaaagtgattttgcaggtccaggg
gacacaatgcagatggaacttccccctctggaaataaactccagagtttctttgaagctt
ggagaaactatagagtctggcacagttatattctgtgatgtcttgccaggaaaagaaagc
ttagggtattttgttggtgtggacatggataatcctattggcaattgggatggcagattt
gatggagtgcagctttgtagtttcgcaagtgttgaaagtacaattctcttgcacatcaat
gatatcatcccagatagcgtgacacaggaaaggaggcctcccaaacttgcctttatgtca
agaggtgttggggacaaaggttcatccagtcataataaaccaaaggccacaggatctacc
tcagaccctggaaatagaaacagatctgaattcttttatactttaaatggatcttctgtt
gactcacaaccacaatccaaatcaaaaaacacatggtacattgatgaagttgctgaagac
cctgcaaagtcgcttacagagatagctccagactttggacacgcttcaccaccactgcag
cctccttccatgaactcattatccaccgagaacagatttcactctttaccattcagtctg
acaaagatgcccaataccaacggaagtattggccacagtccactgtctctgtcagttcag
tccgtgatgggagagctaaacaatgcacctgtccaggagagtccacccttggccgtgact
tctgggaactcacatggtctggaagtgggctctctggctgaggttaaagagaatcctcct
ttctatggcgtaatccgttggattggccagccaccaggactcaacgaagtgctagctgga
ttggaactggaagatgaatgtgcgggctgtacggatggaaccttcaggggcacgcggtac
ttcacctgtgccctgaagaaggcgctgtttgttaaactgaagagctgcaggccggactct
aggttcgcgtctctgcagccagtttccaatcagatcgaacgctgtaactctctagcattt
ggaggctacttgagtgaagtggtggaagaaaataccccacccaaaatggaaaaagaaggt
ttagagataatgattggaaagaagaagggtatccagggtcattacaattcttgttactta
gactcaaccttattctgcttgtttgcttttagttctgttctggacactgtgttacttaga
ccgaaagagaagaatgatgtggaatattatagcgaaactcaggagctcctgaggacagaa
attgttaatcctctgagaatatatggatatgtgtgtgcaacaaagattatgaaactgagg
aagatacttgaaaaagttgaggctgcatcaggatttacttctgaagaaaaagatcctgaa
gaattcttgaatatcctatttcatcatattttaagggtggagccgttgttaaaaataaga
tcagcaggtcaaaaagtacaagattgttacttctatcaaatttttatggagaaaaatgag
aaagttggagttcctacaattcagcagttattagagtggtcttttatcaacagtaacctg
aaatttgcagaggcaccctcatgtctgattattcagatgcctcgatttggaaaagacttc
aaactctttaaaaaaatttttccttctctggagttaaatataacagatttgcttgaagac
accccgaggcagtgccggatatgcggggggctcgcaatgtacgagtgtagagagtgttat
gatgaccctgacatctccgctggaaacatcaagcagttttgtaaaacctgcaacactcaa
gtccaccttcatcccaagagactgaaccataaatacaacccggtgtcacttcccaaagat
ttacctgactgggactggaggcacggctgcatcccctgccagaagatggaattgtttgct
gttctctgcatagaaacaagccactatgttgctttcgtgaagtatgggaaggacgactct
gcctggctcttctttgacagcatggctgatcgggatggcggccagaacggcttcaacatt
cctcaggtcaccccgtgcccagaggtgggagagtacctgaaaatgtctccggaggacctg
cactccttggactctagaagaatccaaggctgcgcgcgaagactgctctgtgacgcgtac
atgtgcatgtaccagagcccgaccatgagtctgtacaagtaa

DBGET integrated database retrieval system