KEGG   Ailuropoda melanoleuca (giant panda): 100467467Help
Entry
100467467         CDS       T01329                                 

Gene name
CYLD
Definition
cylindromatosis (turban tumor syndrome)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100467467 (CYLD)
  Development
   04380 Osteoclast differentiation
    100467467 (CYLD)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100467467 (CYLD)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C67
   100467467 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 956 aa AA seqDB search
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGI
YQGKQLFQCDEDCGVFVALDKLEILEDDDNGLESDFAGPGDTMQMELPPLEINSRVSLKL
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPALSDSVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSEFFYTLNG
SSVDSQPQSKSKNTWYIDEVAEDPAKSLTEIAPDFGHASPPLQPPSMNSLSTENRFHSLP
FSLTKMPNTNGSIGHSPLSLSVQSVMGELNNAPVQESPPLAVTSGNSHGLEVGSLAEVKE
NPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNS
CYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFME
KNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDL
LEDTPRQCRICGGLAMYECRECYDDPDISAGNIKQFCKTCNTQVHLHPKRLNHKYNPVSL
PKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNG
FNIPQVTPCPEVGEYLKMSPEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagaaaaagttacttcaccctactgggaagagcggatt
ttttatttgcttcttcaagaatgcagtgttacagacaaacaaacacaaaagctccttaaa
gtaccaaaggggagtataggacagtatatccaagatcgttctgtggggcactcaaggatt
ccttctgcaaaaggcaagaaaaatcagattggattaaaaattttagagcaaccacatgca
gttctctttgttgatgaaaaggatgttgtagaaataaatgaaaagttcacagagttgctt
ttggcaattaccaattgtgaagagaggttcagcctgtttaagaacagaaacagactaagt
aaaggcctccagatagatgtgggctgccctgtgaaagtacagctgagatctggggaagaa
aaatttcctggagttgtgcgcttcagaggacccttattagcagagaggacagtgtcggga
atattctttggagtagaattactggaagaaggtcgtggccaaggtttcactgatggaata
tatcaagggaaacagctttttcagtgtgatgaagactgtggagtatttgttgcgttggac
aagctagaaatcctagaagatgatgacaatggattggaaagtgattttgcaggtccaggg
gacacaatgcagatggaacttccccctctggaaataaactccagagtttctttgaagctt
ggagaaactatagagtctggcacagttatattctgtgatgtcttgccaggaaaagaaagc
ttagggtattttgttggtgtggacatggataatcctattggcaattgggatggcagattt
gatggagtgcagctttgtagtttcgcaagtgttgaaagtacaattctcttgcacatcaat
gatatcatcccagctttatcagatagcgtgacacaggaaaggaggcctcccaaacttgcc
tttatgtcaagaggtgttggggacaaaggttcatccagtcataataaaccaaaggccaca
ggatctacctcagaccctggaaatagaaacagatctgaattcttttatactttaaatgga
tcttctgttgactcacaaccacaatccaaatcaaaaaacacatggtacattgatgaagtt
gctgaagaccctgcaaagtcgcttacagagatagctccagactttggacacgcttcacca
ccactgcagcctccttccatgaactcattatccaccgagaacagatttcactctttacca
ttcagtctgacaaagatgcccaataccaacggaagtattggccacagtccactgtctctg
tcagttcagtccgtgatgggagagctaaacaatgcacctgtccaggagagtccacccttg
gccgtgacttctgggaactcacatggtctggaagtgggctctctggctgaggttaaagag
aatcctcctttctatggcgtaatccgttggattggccagccaccaggactcaacgaagtg
ctagctggattggaactggaagatgaatgtgcgggctgtacggatggaaccttcaggggc
acgcggtacttcacctgtgccctgaagaaggcgctgtttgttaaactgaagagctgcagg
ccggactctaggttcgcgtctctgcagccagtttccaatcagatcgaacgctgtaactct
ctagcatttggaggctacttgagtgaagtggtggaagaaaataccccacccaaaatggaa
aaagaaggtttagagataatgattggaaagaagaagggtatccagggtcattacaattct
tgttacttagactcaaccttattctgcttgtttgcttttagttctgttctggacactgtg
ttacttagaccgaaagagaagaatgatgtggaatattatagcgaaactcaggagctcctg
aggacagaaattgttaatcctctgagaatatatggatatgtgtgtgcaacaaagattatg
aaactgaggaagatacttgaaaaagttgaggctgcatcaggatttacttctgaagaaaaa
gatcctgaagaattcttgaatatcctatttcatcatattttaagggtggagccgttgtta
aaaataagatcagcaggtcaaaaagtacaagattgttacttctatcaaatttttatggag
aaaaatgagaaagttggagttcctacaattcagcagttattagagtggtcttttatcaac
agtaacctgaaatttgcagaggcaccctcatgtctgattattcagatgcctcgatttgga
aaagacttcaaactctttaaaaaaatttttccttctctggagttaaatataacagatttg
cttgaagacaccccgaggcagtgccggatatgcggggggctcgcaatgtacgagtgtaga
gagtgttatgatgaccctgacatctccgctggaaacatcaagcagttttgtaaaacctgc
aacactcaagtccaccttcatcccaagagactgaaccataaatacaacccggtgtcactt
cccaaagatttacctgactgggactggaggcacggctgcatcccctgccagaagatggaa
ttgtttgctgttctctgcatagaaacaagccactatgttgctttcgtgaagtatgggaag
gacgactctgcctggctcttctttgacagcatggctgatcgggatggcggccagaacggc
ttcaacattcctcaggtcaccccgtgcccagaggtgggagagtacctgaaaatgtctccg
gaggacctgcactccttggactctagaagaatccaaggctgcgcgcgaagactgctctgt
gacgcgtacatgtgcatgtaccagagcccgaccatgagtctgtacaagtaa

DBGET integrated database retrieval system