KEGG   Ailuropoda melanoleuca (giant panda): 100467490Help
Entry
100467490         CDS       T01329                                 

Definition
serine/threonine-protein kinase PRKX-like
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Amoebiasis
HTLV-I infection
Epstein-Barr virus infection
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:aml04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:aml04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:aml04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:aml04340]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:aml04020]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:aml04114]
Cellular Processes; Cell growth and death; Apoptosis [PATH:aml04210]
Cellular Processes; Cell communication; Gap junction [PATH:aml04540]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:aml04062]
Organismal Systems; Endocrine system; Insulin secretion [PATH:aml04911]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:aml04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:aml04912]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:aml04913]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:aml04915]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:aml04914]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:aml04921]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:aml04918]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:aml04919]
Organismal Systems; Endocrine system; Melanogenesis [PATH:aml04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:aml04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:aml04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:aml04970]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:aml04971]
Organismal Systems; Digestive system; Bile secretion [PATH:aml04976]
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:aml04962]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:aml04961]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:aml04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:aml04727]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:aml04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:aml04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:aml04726]
Organismal Systems; Nervous system; Long-term potentiation [PATH:aml04720]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:aml04723]
Organismal Systems; Sensory system; Olfactory transduction [PATH:aml04740]
Organismal Systems; Sensory system; Taste transduction [PATH:aml04742]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:aml04750]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:aml04713]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:aml05205]
Human Diseases; Cancers; Viral carcinogenesis [PATH:aml05203]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:aml05012]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:aml05020]
Human Diseases; Substance dependence; Cocaine addiction [PATH:aml05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:aml05031]
Human Diseases; Substance dependence; Morphine addiction [PATH:aml05032]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:aml05414]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:aml05166]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:aml05169]
Human Diseases; Infectious diseases; Amoebiasis [PATH:aml05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 385 aa AA seqDB search
LAKPSRQGRVSVKNRPLPDARTERQDTPHRVQAWNGPDAFKPGEESRGETPDGAPALCPS
PEAPSPEPPAYRLQDFDTLATVGTGTFGRVQLVKDKTAKHFFALKVMSIPDVIRLKQEQH
VHNEKSVLKEVSHPFLVKLFWTCHDERFLYMLMEFVPGGELFSYLRNRGRFSSSTGLFYS
AEIVCAIEYLHSKEIVYRDLKPENILLDREGHIKLTDFGFAKKLVDKTWTLCGTPEYLAP
EVIQSKGHGRAVDWWALGILIFEMHSGFPPFFDDNPFGIYQKILAGKIDFPRHLDFSVKD
LIRKLLVVDRTRRLGNMKNGADDVKRHRWFRTVDWEAVPQRKLKPPIVPKLCGEGDTSNF
EAYPENDWNAAPPVSPKDLEVFKNF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttggccaagccaagcagacagggccgggtgtctgtaaaaaaccgccccctccccgacgcc
aggactgagcggcaggacaccccccaccgcgtccaagcttggaatggcccagatgccttc
aaaccaggtgaagagagccgtggggagacccccgacggggcgcccgcgctctgccccagc
cccgaggcgccctcgccggagcctccagcctaccgcctgcaggacttcgacacgctggcc
accgtgggcaccgggacgttcggacgggtgcagctggtcaaggacaagacggccaagcat
ttcttcgccctgaaggtaatgagcatccctgacgtcatccggctgaagcaggaacagcat
gtgcacaacgagaagtcagtgctgaaggaagtcagccacccgttcctggtcaagctgttc
tggacgtgccacgacgagcgcttcctgtacatgctgatggagttcgtgccgggcggcgag
ctcttcagctacctgcgcaaccggggccgcttctccagcagcacggggctcttctattcc
gcggagatcgtctgcgccattgagtacctgcactccaaggagattgtctacagggacctg
aagccggagaacatactgctggacagggagggtcacatcaagctcacggactttggcttc
gccaagaagctggtcgacaagacgtggaccctttgtggaacacccgagtacctggctccc
gaagtcatccagagcaaaggccacgggagagccgtggactggtgggcactcggcatcctg
atatttgaaatgcactcggggtttcctccgttttttgatgacaacccatttggcatttat
caaaaaatccttgcgggcaagatagatttccccagacatttggatttcagtgtaaaagac
ctcattaggaaattgcttgttgttgacagaaccagacgccttggaaacatgaagaacgga
gcagatgacgtaaagcggcaccggtggttccgaactgtggattgggaggcggtcccacaa
aggaaactgaagccccccatcgtgccgaagttgtgcggcgagggcgatacgtccaacttc
gaagcctacccggagaatgactggaacgcggcccctccagtgtcgccgaaggatttggaa
gtcttcaagaatttctga

DBGET integrated database retrieval system