KEGG   Ailuropoda melanoleuca (giant panda): 100467490Help
Entry
100467490         CDS       T01329                                 

Gene name
PRKX
Definition
(RefSeq) protein kinase, X-linked
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Regulation of lipolysis in adipocytes
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Amoebiasis
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100467490 (PRKX)
   04010 MAPK signaling pathway
    100467490 (PRKX)
   04310 Wnt signaling pathway
    100467490 (PRKX)
   04340 Hedgehog signaling pathway
    100467490 (PRKX)
   04020 Calcium signaling pathway
    100467490 (PRKX)
   04024 cAMP signaling pathway
    100467490 (PRKX)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100467490 (PRKX)
   04210 Apoptosis
    100467490 (PRKX)
  Cellular commiunity
   04540 Gap junction
    100467490 (PRKX)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100467490 (PRKX)
   04062 Chemokine signaling pathway
    100467490 (PRKX)
  Endocrine system
   04911 Insulin secretion
    100467490 (PRKX)
   04910 Insulin signaling pathway
    100467490 (PRKX)
   04922 Glucagon signaling pathway
    100467490 (PRKX)
   04923 Regulation of lipolysis in adipocyte
    100467490 (PRKX)
   04912 GnRH signaling pathway
    100467490 (PRKX)
   04913 Ovarian Steroidogenesis
    100467490 (PRKX)
   04915 Estrogen signaling pathway
    100467490 (PRKX)
   04914 Progesterone-mediated oocyte maturation
    100467490 (PRKX)
   04921 Oxytocin signaling pathway
    100467490 (PRKX)
   04918 Thyroid hormone synthesis
    100467490 (PRKX)
   04919 Thyroid hormone signaling pathway
    100467490 (PRKX)
   04916 Melanogenesis
    100467490 (PRKX)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100467490 (PRKX)
   04270 Vascular smooth muscle contraction
    100467490 (PRKX)
  Digestive system
   04970 Salivary secretion
    100467490 (PRKX)
   04971 Gastric acid secretion
    100467490 (PRKX)
   04976 Bile secretion
    100467490 (PRKX)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100467490 (PRKX)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100467490 (PRKX)
  Nervous system
   04724 Glutamatergic synapse
    100467490 (PRKX)
   04727 GABAergic synapse
    100467490 (PRKX)
   04725 Cholinergic synapse
    100467490 (PRKX)
   04728 Dopaminergic synapse
    100467490 (PRKX)
   04726 Serotonergic synapse
    100467490 (PRKX)
   04720 Long-term potentiation
    100467490 (PRKX)
   04723 Retrograde endocannabinoid signaling
    100467490 (PRKX)
  Sensory system
   04740 Olfactory transduction
    100467490 (PRKX)
   04742 Taste transduction
    100467490 (PRKX)
   04750 Inflammatory mediator regulation of TRP channels
    100467490 (PRKX)
  Environmental adaptation
   04713 Circadian entrainment
    100467490 (PRKX)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100467490 (PRKX)
   05205 Proteoglycans in cancer
    100467490 (PRKX)
   05203 Viral carcinogenesis
    100467490 (PRKX)
  Neurodegenerative diseases
   05012 Parkinson's disease
    100467490 (PRKX)
   05020 Prion diseases
    100467490 (PRKX)
  Substance dependence
   05030 Cocaine addiction
    100467490 (PRKX)
   05031 Amphetamine addiction
    100467490 (PRKX)
   05032 Morphine addiction
    100467490 (PRKX)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100467490 (PRKX)
  Infectious diseases
   05166 HTLV-I infection
    100467490 (PRKX)
   05169 Epstein-Barr virus infection
    100467490 (PRKX)
   05146 Amoebiasis
    100467490 (PRKX)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100467490 (PRKX)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100467490 (PRKX)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100467490 (PRKX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 349 aa AA seqDB search
AATDPDPQESRGETPDGAPALCPSPEAPSPEPPAYRLQDFDTLATVGTGTFGRVQLVKDK
TAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLVKLFWTCHDERFLYMLMEFV
PGGELFSYLRNRGRFSSSTGLFYSAEIVCAIEYLHSKEIVYRDLKPENILLDREGHIKLT
DFGFAKKLVDKTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMHSGFPPFFDDNP
FGIYQKILAGKIDFPRHLDFSVKDLIRKLLVVDRTRRLGNMKNGADDVKRHRWFRTVDWE
AVPQRKLKPPIVPKLCGEGDTSNFEAYPENDWNAAPPVSPKDLEVFKNF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gccgcgacggaccccgatcctcaggagagccgtggggagacccccgacggggcgcccgcg
ctctgccccagccccgaggcgccctcgccggagcctccagcctaccgcctgcaggacttc
gacacgctggccaccgtgggcaccgggacgttcggacgggtgcagctggtcaaggacaag
acggccaagcatttcttcgccctgaaggtaatgagcatccctgacgtcatccggctgaag
caggaacagcatgtgcacaacgagaagtcagtgctgaaggaagtcagccacccgttcctg
gtcaagctgttctggacgtgccacgacgagcgcttcctgtacatgctgatggagttcgtg
ccgggcggcgagctcttcagctacctgcgcaaccggggccgcttctccagcagcacgggg
ctcttctattccgcggagatcgtctgcgccattgagtacctgcactccaaggagattgtc
tacagggacctgaagccggagaacatactgctggacagggagggtcacatcaagctcacg
gactttggcttcgccaagaagctggtcgacaagacgtggaccctttgtggaacacccgag
tacctggctcccgaagtcatccagagcaaaggccacgggagagccgtggactggtgggca
ctcggcatcctgatatttgaaatgcactcggggtttcctccgttttttgatgacaaccca
tttggcatttatcaaaaaatccttgcgggcaagatagatttccccagacatttggatttc
agtgtaaaagacctcattaggaaattgcttgttgttgacagaaccagacgccttggaaac
atgaagaacggagcagatgacgtaaagcggcaccggtggttccgaactgtggattgggag
gcggtcccacaaaggaaactgaagccccccatcgtgccgaagttgtgcggcgagggcgat
acgtccaacttcgaagcctacccggagaatgactggaacgcggcccctccagtgtcgccg
aaggatttggaagtcttcaagaatttctga

DBGET integrated database retrieval system