KEGG   Ailuropoda melanoleuca (giant panda): 100467523Help
Entry
100467523         CDS       T01329                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, short chain 1
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00062  Fatty acid elongation
aml00071  Fatty acid degradation
aml00280  Valine, leucine and isoleucine degradation
aml00310  Lysine degradation
aml00380  Tryptophan metabolism
aml00410  beta-Alanine metabolism
aml00640  Propanoate metabolism
aml00650  Butanoate metabolism
aml01100  Metabolic pathways
aml01200  Carbon metabolism
aml01212  Fatty acid metabolism
Module
aml_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
aml_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
aml_M00085  Fatty acid biosynthesis, elongation, mitochondria
aml_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100467523 (ECHS1)
   00650 Butanoate metabolism
    100467523 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    100467523 (ECHS1)
   00071 Fatty acid degradation
    100467523 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100467523 (ECHS1)
   00310 Lysine degradation
    100467523 (ECHS1)
   00380 Tryptophan metabolism
    100467523 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100467523 (ECHS1)
Enzymes [BR:aml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100467523 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 100467523
NCBI-ProteinID: XP_002928739
Ensembl: ENSAMEG00000003240
Position
Un
AA seq 289 aa AA seqDB search
MAALRAMLSLLRGPLXPPARLPLRPFASGAGFQYIIAEKKGKNSNVGFIQLNRPKALNAL
CNGLIVELNQALEAFEEDPAVGAIVITGGEKAFAAGADIKEMQNQTFQDCYSRKFLSHWD
RLSHVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFAQPEILLGTIPGAGGTQRLTR
AVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVERLVEEAIQCAEKIASNSKIVAAMAK
ESVNAAFEMTLTEGNKLEKKLFYSTFATEDRKEGMTAFVEKRKASFKDQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctacgcgccatgctgtccctcctccgcggcccgctgncgcctccggcccgg
ctgcccttgcgccccttcgcctccggtgctggctttcagtacatcattgcagaaaagaag
gggaagaacagcaacgtgggcttcatccagctgaatcgccccaaagcactcaacgcactc
tgcaatggcctgatcgtggagctcaaccaggccctggaggccttcgaggaggatccagct
gtgggagccatcgtcatcacgggtggggagaaggcgtttgcagctggagccgatatcaag
gagatgcaaaaccaaacattccaggactgttactccaggaagttcttgagccactgggac
cgactttcccatgtcaagaagccggtcatagctgctgtcaatggctacgctcttggtggc
ggctgcgaactcgctatgatgtgtgacattatttatgctggagaaaaagcccagtttgca
cagccggaaatcctactaggaaccatcccaggtgcagggggcacccagagactgacccgt
gctgttggaaagtcactggccatggagatggttctcactggtgaccggatctctgcccag
gatgccaagcaagcaggtctcgtaagcaaaatttttcctgtggagagactggtcgaagaa
gccatccagtgtgcagagaaaattgccagcaattctaaaatcgtagcagcaatggccaaa
gagtccgtgaatgcagcttttgaaatgacgctaacagagggaaacaagctggagaagaag
ctcttctattcaacttttgctaccgaagatcggaaagaagggatgaccgcgtttgtggaa
aagagaaaggccagcttcaaagaccagtga

DBGET integrated database retrieval system