KEGG   Ailuropoda melanoleuca (giant panda): 100467523Help
Entry
100467523         CDS       T01329                                 

Definition
enoyl-CoA hydratase, mitochondrial-like
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100467523
   01212 Fatty acid metabolism
    100467523
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100467523
   00650 Butanoate metabolism
    100467523
  Lipid metabolism
   00062 Fatty acid elongation
    100467523
   00071 Fatty acid degradation
    100467523
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100467523
   00310 Lysine degradation
    100467523
   00380 Tryptophan metabolism
    100467523
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100467523
Enzymes [BR:aml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100467523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 289 aa AA seqDB search
MAALRAMLSLLRGPLXPPARLPLRPFASGAGFQYIIAEKKGKNSNVGFIQLNRPKALNAL
CNGLIVELNQALEAFEEDPAVGAIVITGGEKAFAAGADIKEMQNQTFQDCYSRKFLSHWD
RLSHVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFAQPEILLGTIPGAGGTQRLTR
AVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVERLVEEAIQCAEKIASNSKIVAAMAK
ESVNAAFEMTLTEGNKLEKKLFYSTFATEDRKEGMTAFVEKRKASFKDQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctacgcgccatgctgtccctcctccgcggcccgctgncgcctccggcccgg
ctgcccttgcgccccttcgcctccggtgctggctttcagtacatcattgcagaaaagaag
gggaagaacagcaacgtgggcttcatccagctgaatcgccccaaagcactcaacgcactc
tgcaatggcctgatcgtggagctcaaccaggccctggaggccttcgaggaggatccagct
gtgggagccatcgtcatcacgggtggggagaaggcgtttgcagctggagccgatatcaag
gagatgcaaaaccaaacattccaggactgttactccaggaagttcttgagccactgggac
cgactttcccatgtcaagaagccggtcatagctgctgtcaatggctacgctcttggtggc
ggctgcgaactcgctatgatgtgtgacattatttatgctggagaaaaagcccagtttgca
cagccggaaatcctactaggaaccatcccaggtgcagggggcacccagagactgacccgt
gctgttggaaagtcactggccatggagatggttctcactggtgaccggatctctgcccag
gatgccaagcaagcaggtctcgtaagcaaaatttttcctgtggagagactggtcgaagaa
gccatccagtgtgcagagaaaattgccagcaattctaaaatcgtagcagcaatggccaaa
gagtccgtgaatgcagcttttgaaatgacgctaacagagggaaacaagctggagaagaag
ctcttctattcaacttttgctaccgaagatcggaaagaagggatgaccgcgtttgtggaa
aagagaaaggccagcttcaaagaccagtga

DBGET integrated database retrieval system