KEGG   Ailuropoda melanoleuca (giant panda): 100467619Help
Entry
100467619         CDS       T01329                                 

Gene name
RNASE1
Definition
(RefSeq) ribonuclease, RNase A family, 1 (pancreatic)
  KO
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     100467619 (RNASE1)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     100467619 (RNASE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 247 aa AA seqDB search
MLQERLPRPRTAAHLPPTPRRAEVASIGRGHKSLPPPCLGTVPPRPQIHAAVQRQAAGTH
SPPHRRGAVGIPAGLLGRERTSLSLLFWLFWRSETTMAQEKFFILFPLLVLVLLALGCVQ
PSLGKESRAKKFQRQHMDSDTSIVGSSYCNQMMKRRNMTAGWCKPVNTFVHEPLPDVQAV
CLQKNVTCKNGQPDCHQSSSRMHITDCRLKRGSKYPKCEYQTEQKEKSIIVACGGNPYVP
VHFDASV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctccaggagcggttgccacggccgagaacggccgcacacctgccacccacacccagg
agagctgaagtggccagcattgggcgaggtcacaagtctcttccacctccctgcctggga
actgtcccccccagaccccagatccacgcggccgtccagcggcaggcagctggaactcac
tcccctccccacagaagaggtgctgtgggaattccagccgggctcttggggagagagagg
acctccctttccctgctgttctggctcttctggaggagcgagaccaccatggctcaggag
aagttcttcatcctgttcccactactggtcctggtgctgctggcgctgggctgtgtccag
ccgtctctgggcaaggagtcccgggccaagaagttccagcggcagcacatggactcggac
acctccatcgtcggctccagctactgcaaccaaatgatgaagcggcggaacatgacggcc
gggtggtgcaagccggtgaacacctttgtccacgagcctctgcccgacgtccaggccgtc
tgcctccagaaaaatgtcacctgcaagaacgggcagcccgactgccaccagagcagctcc
aggatgcacatcaccgactgccgcctgaagcgtggctccaagtacccgaaatgcgagtat
cagacggagcagaaggagaaatccatcatcgtggcctgtggggggaacccgtatgtgccg
gtccacttcgacgcttccgtgtag

DBGET integrated database retrieval system