KEGG   Ailuropoda melanoleuca (giant panda): 100467650Help
Entry
100467650         CDS       T01329                                 

Gene name
YWHAH
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta
  KO
K16198  
14-3-3 protein gamma/eta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    100467650 (YWHAH)
   04151 PI3K-Akt signaling pathway
    100467650 (YWHAH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100467650 (YWHAH)
   04114 Oocyte meiosis
    100467650 (YWHAH)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100467650 (YWHAH)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100467650 (YWHAH)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100467650 (YWHAH)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100467650 (YWHAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 221 aa AA seqDB search
GILQVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAY
REKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNS
VVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAI
AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gggattttgcaggtgacagagctcaatgaacctctttctaatgaagatcgaaacctcctc
tcggtggcctacaagaacgtggttggtgccaggcgatcttcctggagggtcatcagcagc
attgagcagaaaaccatggctgatggaaatgaaaaaaaattggagaaagttaaagcttac
cgggagaagattgagaaggagctggaaacagtgtgcaatgatgtcctggcgctgctcgac
aagttcctcatcaagaactgcaatgatttccagtatgagagcaaggtattttacctgaaa
atgaaaggcgattactaccgctacttggcagaggtagcttccggggagaagaaaaacagt
gtggtcgaagcttccgaggccgcctacaaggaagcctttgaaatcagcaaagagcacatg
cagccgacgcaccccatccggctgggtctggccctcaacttctccgtgttctactatgag
atccagaatgcacctgagcaggcctgcctcttagccaaacaagccttcgatgatgccata
gctgagctggacacactaaacgaggattcctataaggactccacgctcatcatgcagttg
ctgcgagacaacctcaccctctggacgagcgaccagcaggatgaagaagcaggagaaggc
aactga

DBGET integrated database retrieval system