KEGG   Ailuropoda melanoleuca (giant panda): 100467650Help
Entry
100467650         CDS       T01329                                 

Definition
14-3-3 protein eta-like
Orthology
K16198  
14-3-3 protein gamma/eta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    100467650
   04151 PI3K-Akt signaling pathway
    100467650
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100467650
   04114 Oocyte meiosis
    100467650
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100467650
  Infectious diseases
   05169 Epstein-Barr virus infection
    100467650
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100467650
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100467650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 272 aa AA seqDB search
MNLTVRKTWVHILTAPTSSMTVGCGLSRSGGQLCSQLNNQKALRRSGAAVERMVKVTELN
EPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELE
TVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAY
KEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNED
SYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgacagtcagaaagacctgggtgcacatcctgactgcccctactagctccatg
accgtggggtgtggtttaagccgcagtggaggacagttatgctcacagctcaacaaccaa
aaggctctcaggaggtccggggcagcagtggagagaatggtgaaggtgacagagctcaat
gaacctctttctaatgaagatcgaaacctcctctcggtggcctacaagaacgtggttggt
gccaggcgatcttcctggagggtcatcagcagcattgagcagaaaaccatggctgatgga
aatgaaaaaaaattggagaaagttaaagcttaccgggagaagattgagaaggagctggaa
acagtgtgcaatgatgtcctggcgctgctcgacaagttcctcatcaagaactgcaatgat
ttccagtatgagagcaaggtattttacctgaaaatgaaaggcgattactaccgctacttg
gcagaggtagcttccggggagaagaaaaacagtgtggtcgaagcttccgaggccgcctac
aaggaagcctttgaaatcagcaaagagcacatgcagccgacgcaccccatccggctgggt
ctggccctcaacttctccgtgttctactatgagatccagaatgcacctgagcaggcctgc
ctcttagccaaacaagccttcgatgatgccatagctgagctggacacactaaacgaggat
tcctataaggactccacgctcatcatgcagttgctgcgagacaacctcaccctctggacg
agcgaccagcaggatgaagaagcaggagaaggcaactga

DBGET integrated database retrieval system