KEGG   Ailuropoda melanoleuca (giant panda): 100467650Help
Entry
100467650         CDS       T01329                                 

Definition
14-3-3 protein eta-like
Orthology
K16198  
14-3-3 protein gamma/eta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:aml04390]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:aml04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:aml04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:aml04114]
Human Diseases; Cancers; Viral carcinogenesis [PATH:aml05203]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:aml05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 272 aa AA seqDB search
MNLTVRKTWVHILTAPTSSMTVGCGLSRSGGQLCSQLNNQKALRRSGAAVERMVKVTELN
EPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELE
TVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAY
KEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNED
SYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgacagtcagaaagacctgggtgcacatcctgactgcccctactagctccatg
accgtggggtgtggtttaagccgcagtggaggacagttatgctcacagctcaacaaccaa
aaggctctcaggaggtccggggcagcagtggagagaatggtgaaggtgacagagctcaat
gaacctctttctaatgaagatcgaaacctcctctcggtggcctacaagaacgtggttggt
gccaggcgatcttcctggagggtcatcagcagcattgagcagaaaaccatggctgatgga
aatgaaaaaaaattggagaaagttaaagcttaccgggagaagattgagaaggagctggaa
acagtgtgcaatgatgtcctggcgctgctcgacaagttcctcatcaagaactgcaatgat
ttccagtatgagagcaaggtattttacctgaaaatgaaaggcgattactaccgctacttg
gcagaggtagcttccggggagaagaaaaacagtgtggtcgaagcttccgaggccgcctac
aaggaagcctttgaaatcagcaaagagcacatgcagccgacgcaccccatccggctgggt
ctggccctcaacttctccgtgttctactatgagatccagaatgcacctgagcaggcctgc
ctcttagccaaacaagccttcgatgatgccatagctgagctggacacactaaacgaggat
tcctataaggactccacgctcatcatgcagttgctgcgagacaacctcaccctctggacg
agcgaccagcaggatgaagaagcaggagaaggcaactga

DBGET integrated database retrieval system