KEGG   Ailuropoda melanoleuca (giant panda): 100467683Help
Entry
100467683         CDS       T01329                                 

Definition
calcineurin subunit B type 1-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Oxytocin signaling pathway
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100467683
   04310 Wnt signaling pathway
    100467683
   04370 VEGF signaling pathway
    100467683
   04020 Calcium signaling pathway
    100467683
   04022 cGMP - PKG signaling pathway
    100467683
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100467683
   04210 Apoptosis
    100467683
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100467683
   04660 T cell receptor signaling pathway
    100467683
   04662 B cell receptor signaling pathway
    100467683
  Endocrine system
   04921 Oxytocin signaling pathway
    100467683
  Nervous system
   04724 Glutamatergic synapse
    100467683
   04720 Long-term potentiation
    100467683
  Development
   04360 Axon guidance
    100467683
   04380 Osteoclast differentiation
    100467683
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100467683
   05014 Amyotrophic lateral sclerosis (ALS)
    100467683
  Substance dependence
   05031 Amphetamine addiction
    100467683
  Infectious diseases
   05152 Tuberculosis
    100467683
   05166 HTLV-I infection
    100467683
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100467683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 172 aa AA seqDB search
MNFVLSEQLCQEHCSKVDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRV
IDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKM
MVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgttctttctgaacaactgtgccaagagcattgtagcaaagttgatgctgat
gaaattaaaaggctaggaaagagatttaagaagctcgacttggacaattcgggatctttg
agtgtggaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagta
atagatatatttgacacagatgggaatggagaagtagactttaaagaattcattgaggga
gtctctcagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatc
tatgacatggataaagatggctatatttccaatggggaactcttccaggtgctgaagatg
atggtggggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataata
aatgcagataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggt
ggcctagatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system