KEGG   Ailuropoda melanoleuca (giant panda): 100467683Help
Entry
100467683         CDS       T01329                                 

Gene name
PPP3R1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04720  Long-term potentiation
aml04724  Glutamatergic synapse
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04924  Renin secretion
aml05010  Alzheimer's disease
aml05014  Amyotrophic lateral sclerosis (ALS)
aml05031  Amphetamine addiction
aml05152  Tuberculosis
aml05166  HTLV-I infection
aml05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100467683 (PPP3R1)
   04310 Wnt signaling pathway
    100467683 (PPP3R1)
   04370 VEGF signaling pathway
    100467683 (PPP3R1)
   04020 Calcium signaling pathway
    100467683 (PPP3R1)
   04022 cGMP - PKG signaling pathway
    100467683 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100467683 (PPP3R1)
   04218 Cellular senescence
    100467683 (PPP3R1)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100467683 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    100467683 (PPP3R1)
   04660 T cell receptor signaling pathway
    100467683 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    100467683 (PPP3R1)
   04659 Th17 cell differentiation
    100467683 (PPP3R1)
   04662 B cell receptor signaling pathway
    100467683 (PPP3R1)
  Endocrine system
   04922 Glucagon signaling pathway
    100467683 (PPP3R1)
   04921 Oxytocin signaling pathway
    100467683 (PPP3R1)
   04924 Renin secretion
    100467683 (PPP3R1)
  Nervous system
   04724 Glutamatergic synapse
    100467683 (PPP3R1)
   04720 Long-term potentiation
    100467683 (PPP3R1)
  Development
   04360 Axon guidance
    100467683 (PPP3R1)
   04380 Osteoclast differentiation
    100467683 (PPP3R1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100467683 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    100467683 (PPP3R1)
  Substance dependence
   05031 Amphetamine addiction
    100467683 (PPP3R1)
  Infectious diseases
   05152 Tuberculosis
    100467683 (PPP3R1)
   05166 HTLV-I infection
    100467683 (PPP3R1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100467683 (PPP3R1)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100467683 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 100467683
NCBI-ProteinID: XP_011230746
Position
Un
AA seq 160 aa AA seqDB search
MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ
QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcacactttgatgctgatgaaattaaaaggctaggaaagagatttaagaagctc
gacttggacaattcgggatctttgagtgtggaagagttcatgtctctgcctgagttacaa
cagaatcctttagtacagcgagtaatagatatatttgacacagatgggaatggagaagta
gactttaaagaattcattgagggagtctctcagttcagtgtcaaaggagataaggaacag
aagttgaggtttgctttccgtatctatgacatggataaagatggctatatttccaatggg
gaactcttccaggtgctgaagatgatggtggggaacaatctgaaagatacacagttacag
caaattgtagacaaaaccataataaatgcagataaggatggagatggaagaatatccttt
gaagaattctgtgctgttgtaggtggcctagatatccacaaaaagatggtggtagatgtg
tga

DBGET integrated database retrieval system