KEGG   Ailuropoda melanoleuca (giant panda): 100467791Help
Entry
100467791         CDS       T01329                                 

Gene name
FLNA
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100467791 (FLNA)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100467791 (FLNA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100467791 (FLNA)
  Infectious diseases
   05132 Salmonella infection
    100467791 (FLNA)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100467791 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2522 aa AA seqDB search
SKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKLPQLPI
TNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPE
EIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFT
VETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHI
AKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPAG
QKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPGACRA
VGRGLQPKGVRVKETADFKVYTKGAGSGELKVAVKGPKGEERVKQKDLGDGVYGFEYYPT
VPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDD
VGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRE
APQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKATLRVQVQDNEGYPVEAAVKD
NGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLK
AHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPRGAGS
YTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKG
KLDVQFSGLAKGDAARDVDIIDHHDNTYTVKYTPVQQGPLGINVTYGGDPIPKSPFSVGV
SPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKITGPSGTVVPCKVEPGLG
ADNSVIRFVPREEGPYEVEVTYDGVPVPGSPFPVEALPPTKPSKVKAFGPGLQGGSAGSP
ARFTIDTKGAGMGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHI
PGSPFKAHVVPCFDASKVKCSGPGLERATAGEAGQFHVDCSSAGSAELTIEIRSEAGLPA
EVHIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGV
EGRGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDCGDGTYKVEYTPYE
EGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGT
GGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDV
TDASKVKCSGPGLSPGMVRASLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADG
TQTVNYVPSREGPYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLP
VEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGD
EIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVT
CTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQ
PTAQPPLRPQQLAPPYTYAQGGQQTWAPERPLMGVNGLDVTSLRPFDLVIPFTIKKGEIT
GEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNC
GHVTAYGPGLTHGVVNKPAVFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYL
PVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTA
TVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIG
DASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVT
YCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLK
IPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSP
FQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISF
EDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGL
KVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVK
FNGTHIPGSPFKIRVGEPGHGGDPGMVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVT
IDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNH
SLHETSSVFVDSLTKTASAPPHGALGAGSTDASKVLAKGLGLSKAYVGQKSSFTVDCSKA
GNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVL
VP
NT seq 7571 nt NT seq  +upstreamnt  +downstreamnt
acagcaaggccatcgtggacgggaacctgaagctgatcttgggcctcatctggaccctga
tcctgcactactccatctccatgcccatgtgggatgaggaagaggatgaggaggccaaga
agcagacgcctaagcagcggctcctcggctggatccagaacaagctgccgcagctgccca
tcaccaacttcagccgcgactggcagagcggcagggccctgggcgccctcgtcgacagct
gtgccccaggcctgtgtcctgactgggactcctgggatgccagcaagcccgtgaacaacg
cgagggaagccatgcagcaggctgatgactggctgggcatccctcaggtgatcacacctg
aggaaatcgtggaccccaacgtggacgagcactccgtcatgacctacctgtcccagttcc
ccaaggccaagctgaagccaggagctcccctgcggcccaaactaaacccaaagaaagccc
gagcctatgggccaggcatcgagcccacaggcaacatggtgaagaagcgggcagaattca
cagtggagaccagaagtgctggccagggcgaggtgctggtgtacgtggaggacccagccg
gccaccaggaggaggcgaaggtgactgccaataatgacaagaaccgtaccttctctgtct
ggtatgtccccgaggtgaccgggactcacaaggtcactgtgctgtttgccggccagcata
tcgccaagagtccctttgaggtatacgtggacaagtcccagggtgacgcaagcaaagtaa
ctgcccaaggccctggcctggagcccagtggcaacattgccaacaagaccacctactttg
agatcttcacagcaggagctggcacgggtgaggtggaagttgtgatccaggaccctgcgg
gacagaagggcaccgtggagcctcagctggaggcccggggcgacagcacgtaccgctgca
gctaccagcccactatggagggtgtccacacggtgcacgtcaccttcgccggcgtgccga
tccctcgcagcccctacactgtcactgttggccaagcctgtaacccaggtgcctgccgtg
ccgtgggccggggcctccagcccaagggtgtgcgggtgaaagagactgcggacttcaagg
tgtatacgaagggtgctggcagtggagagctgaaggtcgctgtgaagggtcccaagggcg
aggagcgtgtaaagcagaaggacttaggggatggcgtctatggctttgagtattacccca
cggtccccggcacgtacactgtcaccatcacgtggggtggccagaacatcgggcgcagtc
cctttgaggtgaaggtgggcactgagtgtggcaaccagaaggtgcgggcctggggccctg
ggctggaaggtggcgttgttggcaagtcagcagacttcgtggtggaagccatcggggacg
acgtcggcaccttgggcttctcggtggagggcccatcgcaggccaagatcgaatgcgacg
acaagggtgacggctcctgtgatgtgcgctattggccccaggaggctggcgagtatgccg
tgcacgtgctgtgcaacagtgaggacatccgcctcagccccttcatggctgacatccgtg
aggcgccccaggacttccacccagatagggtgaaggcgcgtgggcctggactggagaaga
cgggtgtagctgtcaataagccggccgagttcacggtggatgccaagcatggtgggaagg
ccacgctccgagtccaagtccaggacaacgagggataccccgtggaggcggcggtcaagg
acaacggcaacggcacttacagctgctcgtatgtgcccaggaagcctgtgaagcacacgg
ccatggtgtcctggggcggcgtcagcattcccaacagccccttccgggtgaacgtgggag
ccgggagccacccaaacaaggtcaaggtatatggccccggagtggccaagacagggctca
aggctcatgagccgacgtacttcaccgtggactgcgccgaggccggccagggtgatgtca
gcatcggcatcaagtgtgcccctggcgtggtgggccccacggaggctgacatagactttg
acatcatccgtaacgacaacgacaccttcacggtgaagtacacaccccgcggagctggta
gctataccatcatggtcctcttcgccgatcaggccacacccaccagccccatccgggtca
aggtggagccctcccacgatgccagcaaggtgaaggccgagggccctggcctcagtcgca
ctggtgtcgagcttggcaaacccacccacttcacagtcaatgccaaagctgctggcaaag
gcaagctggacgtccagttctcagggctggccaagggggatgcggcgcgtgacgtggata
tcattgaccaccatgacaacacctacacggtcaagtacacccctgtgcagcagggtccac
tgggcattaacgtcacttatggaggggatcccatccccaagagccccttctcggtggggg
tgtctccaagcctagacctcagcaagatcaaggtgtctggcctgggagaaaaggtggatg
ttggcaaagatcaggagttcacagtcaaatcgaagggtgctggcggccaaggcaaagtgg
cgtccaagatcacaggcccctcgggcacagtagtgccctgcaaggtggagccgggcctgg
gggccgacaacagcgtgatacgctttgtgccccgagaggaggggccctatgaggttgagg
tgacttacgacggtgtgcctgtgcctggcagcccctttcctgtggaagccctgcccccca
ccaagcctagcaaggtgaaggcgtttgggccagggctacaggggggcagtgcaggctccc
ctgcccgtttcactattgacaccaagggtgccggcatgggcggcctgggcctgacagtgg
agggcccctgcgaggcccagctcgagtgcctggacaacggggatggcacgtgctccgtgt
cctatgtgcccactgaacccggagactacaatatcaacattctcttcgccgacacccata
tccccggctccccattcaaggcccacgtggttccctgcttcgacgcatccaaagtcaagt
gctccggccctgggttggagcgggccacggctggtgaggcgggccagttccacgtagact
gctcgagcgcaggcagcgcagagctaaccatcgaaatccgctctgaggcagggctgccag
ccgaggtgcacatccaggaccatggtgatggtacacacaccatcacctacatcccgcttt
gccctggggcctataccgtcaccatcaagtacggtggccagcctgtgcccaacttcccca
gcaagctgcaggtggagcccgcggtagacacttcaggcgtccagtgctacgggcctgggg
tcgagggccgaggtgtcttccgagaggctaccaccgagttcagcgtggatgcccgtgctc
tgacgcagactggagggccgcacgtcaaggctcgtgtggccaacccctcaggtaacctga
ccgagacctatgtgcaggactgcggcgacggcacatacaaagtggagtacaccccatatg
aggaaggactccactccgtggacgtgacctacgatggcagccccgtgcccagcagcccat
tccaggtgcctgtgaccgagggctgtgacccttcccgagtgcgtgtccacgggccaggta
tccaaagcggcaccaccaacaagcccaacaagttcaccgtggagactaggggagctggca
ctgggggcctgggcctggccgtagagggcccctccgaggccaagatgtcctgcatggata
acaaggatggcagctgttcggtcgaatacatcccctacgaggctggcacctatagcctta
acgtcacctatggtggccaccaagtgccaggcagtcccttcaaggtccctgtgcatgacg
tgacagatgcatccaaggtcaagtgctctggccctggcctgagccctggcatggtccgtg
ccagcctccctcagtccttccaggtagacacgagcaaggctggtgtggccccactgcagg
tcaaagtgcaagggcccaaaggcctggtggagcctgtggacgtcgtggacaacgctgatg
gcacccagaccgtcaactacgtgcccagccgggaggggccctatagcatctcagtgctgt
atggggaggaagaggtgccccgcagccccttcaaggtcaaggtgctgcctacacatgatg
ccagcaaggtgaaggccagcggccctgggctcaatactactggtgtgcctgccagcctgc
ctgtggagttcaccattgacgcgaaggatgcgggagagggcctgctggctgtccagatca
cggaccccgagggcaagcccaagaagacgcacatccaagacaaccatgatggcacataca
cagtggcctatgtgccggacgtgacaggccgctacaccatcctgatcaagtatggcggtg
acgagatccccttctccccataccgcgtccgggccgtgcccactggagacgccagcaagt
gcacagtcacagtgtcaatcggaggtcacgggctaggtgctggcattggccccaccatcc
agattggggaggagacggtgatcactgtcgacaccaaggcggcaggcaaaggcaaggtga
cctgcaccgtgtgcacacccgacggctccgaggtggacgtggatgtggtagagaacgagg
atggcaccttcgacatcttctacacggccccgcagccgggcaaatatgtcatctgcgtgc
gctttggtggcgagcacgtgcccaacagccctttccaagtgacggctctagctggggacc
agcccacagcacagcccccgcttcggcctcagcagctggccccaccttacacctatgctc
agggtggccagcagacctgggccccggagagacccttgatgggtgtcaatgggttggatg
tgacgagcctgaggccctttgaccttgtcatccccttcaccatcaagaaaggcgagatca
cgggggaggtgaggatgccctcgggcaaggtggcgcagccagccatcactgacaacaagg
atggcaccgtgaccgtccgctacgcacccagtgaagctggcctgcatgagatggacatcc
gctacgataacatgcacatcccaggaagccccctgcagttctatgtggattacgtcaact
gtggccacgtcactgcctatgggcctggcctcacgcatggagtggtgaacaagcctgctg
tcttcaccgttaacaccaaggatgcaggagaggggggcttgtccctggccatcgagggcc
catccaaagcagaaatcagctgcactgacaaccaagatgggacctgcagcgtctcctacc
tgcccgtgctgcccggggattacagcatcctggtcaagtacaacgaacagcacatcccag
gcagccccttcactgccagggtcacaggtgatgactcaatgcgcatgtcccacctgaagg
tgggctctgctgctgatatccccatcaatatctccgagacggacctcagcctgctgacgg
ccacggtcgtgccaccctcgggccgggaggagccctgtctgctgaagcgactgcgcaatg
gccacgtggggatctcgttcgtgcccaaggagactggggagcacctggtgcatgtgaaga
agaatggtcagcatgtggcgagcagccccatcccggtggtgatcagccagtcggagattg
gggatgccagccgtgtgcgggtctcaggccagggcctccatgaaggccacacctttgagc
ctgcagagtttatcatcgacacccgtgatgcaggctatggcgggcttagcttgtccattg
agggccccagcaaggtggacatcaacacagaggacctagaggatggcacatgcagggtca
cctactgccccacagagcctggcaactatattatcaacatcaagttcgctgaccagcacg
tgcctggcagtcccttctctgtgaaggtaacaggagagggccgggtgaaagagagcatca
cacgtcggcgacgggccccttcggtggccaatgttggcagtcattgcgacctcagcctga
agatccctgaaattagcatccaggacatgacagcccaggtaaccagcccatcaggcaaga
gccatgaggccgagattgtggaaggggagaaccatacctactgcatccgctttgtgcctg
ccgagatgggcatgcacacagtcagcgtcaagtacaagggccagcatgtgcctgggagcc
ccttccagttcaccgtggggcccctgggggaagggggagcccacaaagtccgtgctggag
gccccggcctggagagggctgaagctggagtgccagctgaatttagcatctggaccaggg
aagctggcgctgggggcctggccattgctgtcgagggccccagcaaggctgagatctcct
ttgaggaccgaaaggacggctcctgtggtgtggcttatgtggtccaggagccaggtgact
acgaggtctcggtcaagttcaacgaggagcacattcccgacagccccttcgtagtacctg
tggcttctccgtctggcgatgcccggcgccttactgtttctagtcttcaggagtcagggc
taaaggtcaaccagccagcctcttttgcagtcagcctgaacggggccaagggggcgatcg
atgctaaggtgcacagcccctcgggagccctggaggagtgctatgtcacagagatcgacc
aagataagtatgccgtacgctttatcccgcgggagaacggtgtctacctgattgacgtca
agttcaatggcacccacattcctggaagccccttcaagatccgagttggggaacctgggc
atggaggggacccaggcatggtgtccgcctacggagctggcctagaaggtggtgtcacag
ggagcccagctgagttcatcgtgaacacaagcaatgcaggagcgggtgccctgtcagtaa
ccatcgatgggccctccaaggtgaagatggattgccaggagtgccctgagggctaccgtg
tcacctacactcccatggcacctggcagctacctcatctccatcaagtatggtggcccct
accacattgggggcagccccttcaaggccaaagtcacaggtccccgtcttgtcagcaacc
acagcctccatgagacatcatccgtgtttgtggactccctgaccaagactgccagtgccc
ccccgcatggggccctgggtgcaggttccactgatgccagcaaggtgctggccaagggcc
tggggctgagcaaggcctatgtgggccaaaagagcagcttcacagtggactgcagcaaag
caggcaacaacatgctgctggtaggggtgcacggcccccggacaccctgcgaggagatcc
tggtgaagcatgtgggcagccggctctacagcgtgtcttacctgctcaaggacaagggag
agtacacgctggtggtcaagtggggtgatgagcacatcccaggcagcccctaccgtgtcc
tggtcccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system