KEGG   Ailuropoda melanoleuca (giant panda): 100467869Help
Entry
100467869         CDS       T01329                                 

Definition
patatin-like phospholipase domain-containing protein 7-like
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100467869
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100467869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1340 aa AA seqDB search
MKQEEDASPEADFCLGAALQSWGLQLTEQHSQSTMLIGIVIGALLALALIGITIFFVYRR
VNRFRQVQPTPQYRFRKRDKVMFYGRKIMRKVTTLPHTLVGSTAPPRQRMRKRTKVLSLA
KRILHFKKEYPTLQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHMVFVQLLEGEHVFQPGEPDTSIYVVQDGRLEVCIQDTDGTEVAVKEVLAGDSVHS
LLSILDVITGHTAPYKTVSARAAAPSTVLRLPAVAFQGVFEKYPETLARVVQIIMVRLQR
VTFLALHNYLGLTTELFNPESQAIPLVSVASVAAGKTKRQACCGSEDRLERPLRPQESCD
PDRGGSRAAASGPLLKRSQSFPLPSVREEILDELSKAQAGDQTPFAPPGSTAGAALELRM
ACDRARVLLHAEERPGSAVASKAKKNVVVADTPSAVFHYAETNSDETVSSRKTDAIFRAA
KEDLLTLMKLDDPSLLDGRVTLLHVPGGTVVSKQGDQDVNILFVVSGLLHVYQRKIDSEE
DTCLFIVRPGEMVGQLAVLTGEPLIFTIKANRDCSFLSISKAHFYEIMRKQPTVVLGVAH
TVVKRVSSFVRQIDFALDWMEVEAGRAVYRQGDKSDCTYIVLSGRLRSVIRKDDGKKRLA
GEYGRGDLIGVVETLTHQARATTVHAVRDSELAKLPTGALTSIKRRYPQVVTRLIHLLGE
KILGSLQQGTATGHQFGLHTAGSKWDSGNPASNLSTVAVMPVSEDVPLTAFALELKHALS
AIGPILLLTSDNIKQRLGSAALDSIHEYRLSSWLGQQEDIHRIVLYQADSTLTPWTQRCV
RQADCVLIVGLGEQEPTVGELERMLESTAVRAQKQLVLLHREDGPAPSRTVEWLNMRSWC
SGHLHLCCPRRVFSRRSMPKLVEMYQRVFQRPPDRHSDFSRLARVLTGNAIALVLGGGGA
RGCAQVGIIRALTECGIPVDMVGGTSIGAFMGALYSEERNYSQIRIRAKQWAEDMTSMVK
TVLDLTYPITSMFSGAGFNSSVCSVFKDRQIEDLWIPYFTVTTDITASAMRVHTDGSLWR
YVRASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSQDETDLT
NYGDALSGWWVLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEMVKNSEYCEYLRPPI
DSYGTLDFGKFNEICEVGYQHGRTVFDIWGRSGVLEKMLQDRQGTSKMKACDVLTCPNAS
FTDLAEIVSRIEPAKVATVDDESDYQTEYEEELPDGPKDAYADFQSAPAHVGSDSEDESS
LRHRNPSLXFPELPPDSSYP
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagaggaggatgccagcccagaggctgacttctgtctgggtgctgccctgcag
tcctgggggctgcagttgacggagcagcattcacagtccaccatgctgatagggattgtg
attggagccctcctggccctggccctcattggcatcaccatcttttttgtgtacagaagg
gttaaccgattccgacaagtacagcccactcctcagtacaggttccggaagagagacaaa
gtgatgttttatggccggaagatcatgaggaaggtgaccacgctgccccacacgcttgtg
gggagcacggcgcccccccggcagcggatgaggaagaggaccaaggtgctatctttggcc
aagaggattctgcatttcaaaaaggaatacccaaccctgcagccaaaggagccaccaccc
tccctgctggaggctgacctcacggagtttgacgtgaagaattctcacctgccgtcagaa
gttttgtacatgctgaagaacgtgcgggtcctgggccactttgagaagccactgttcctg
gaactttgcaaacacatggtcttcgtgcagctactcgaaggggagcatgtctttcagccg
ggggagccagataccagcatctatgtggtgcaggacgggcgcctggaagtctgcatccag
gacacggacggcactgaggtggcggtcaaagaggttctggccggagacagcgtccacagt
ctcctcagcatcctggacgtcatcaccggccacaccgctccgtacaaaaccgtgtccgcc
cgcgccgccgccccctccaccgtcctccggctccccgcggtggctttccagggagtcttt
gagaagtaccctgaaaccctggccagagtggtgcagatcatcatggtgcggctgcagagg
gtcacctttctggctctgcataactacctgggcctgaccacagagctcttcaacccggag
agccaggccatccccctggtgtctgtggccagtgtggctgctggcaagaccaagaggcag
gcatgctgtggctccgaggatcgtctcgagaggcccctgcggccccaggagtcctgtgac
ccagatcgagggggcagccgtgcagcagcctctgggcctctgctgaagaggagccagtcc
ttcccgctgccttctgtccgcgaagagatcctggatgagctcagcaaggcccaggcaggt
gaccagaccccttttgctccaccagggagcacagcgggagctgccttagagctgaggatg
gcatgtgaccgcgccagggtcctcctccacgcagaggaacgccctgggagtgccgtggcc
agcaaggccaagaagaacgtggttgtggcagacactccctctgcagtcttccactacgca
gagactaactcagacgagaccgtctccagcaggaagacggatgccatcttcagagccgcc
aaggaggacctgctcaccctgatgaagctggacgacccctcgctcttggatggccgggtg
acgcttctccatgttccggggggcacggtggtgtcgaagcagggagaccaggacgtgaac
atcctcttcgtggtctcggggctgctgcacgtgtaccagcggaagattgacagcgaggaa
gacacctgcctgttcatcgtgcgccccggggagatggtaggccagctggctgtgctcacg
ggagagcccctcatcttcaccatcaaggccaacagggactgcagctttctctccatctcc
aaggcacacttctatgagattatgcggaagcagccgactgtggtcctgggcgtcgcgcac
actgtggtgaagcgggtgtcgtccttcgtgcggcagatcgactttgcgctggactggatg
gaggtggaggctgggcgcgcagtgtacaggcagggggacaagtcagactgcacctacatt
gtcctcagtggccggctacgctccgtgatccggaaggacgacggcaaaaagcgcctggcg
ggggagtatggccgtggagacctcatcggtgtggtggagacgctcacccaccaggccagg
gcgaccacagtgcacgccgttcgggactcggagctggccaagcttccgacaggagccctg
acatccatcaagcgcaggtacccacaggttgtgactcggctgatccatctcttgggtgag
aagattctgggcagcctccagcagggaactgcaacaggtcaccagtttgggctacacact
gcaggcagcaagtgggactcggggaaccctgccagcaacctctccacggtggctgtcatg
cctgtgtcggaggacgtgcccctcactgcctttgccctggagctcaagcatgccctcagt
gccatcggccccatcctgctgctgaccagtgacaacataaagcagcgccttggctccgct
gctctggacagtatccacgagtaccggctgtccagctggctggggcagcaggaggacatc
caccggattgtgctctaccaggcggacagcacgctcacgccttggacccagcgctgcgtc
cggcaagctgactgcgtcctcatcgtgggcctgggtgagcaggagcccacggtgggcgag
ctggagcggatgctggagagcacggccgtgcgtgcccagaagcagctggtgctgctgcac
cgggaggacgggccggcgccctcccgcaccgtcgagtggctgaacatgcggagctggtgc
tctggccacctgcacctctgctgccctcgccgcgtcttctccaggagaagcatgcccaag
ctggtggaaatgtaccagcgagtcttccagaggcccccagaccggcactcagacttctcc
cgcctggctcgggtgctgactggcaacgccattgccttggtgcttgggggaggtggggca
agaggctgtgcccaggtcggcatcatccgggccctgacggaatgtggcatccctgtggac
atggttggagggacgtccatcggggccttcatgggcgccctgtactccgaggaacggaac
tacagccagatacggatccgggccaagcagtgggctgaggacatgacgtcgatggtgaag
actgtgctggacctgacctaccctatcacgtccatgttctcgggggccggctttaacagc
agcgtctgtagtgtcttcaaggaccggcagatcgaggacctgtggatcccttacttcacc
gtcaccacagacatcacggcctctgctatgcgcgtccacacggatggctccctgtggagg
tacgtgcgtgccagcatgtctctgtcaggctacatgcctcccctctgcgaccccaaagac
ggacacctgctgatggacgggggttacatcaacaacctcccagcggatgtggccaggtct
atgggggcaaaggtggtgattgccattgacgtgggcagccaggacgagacggacctcacc
aactatggcgacgcactgtctgggtggtgggtgctgtggaagcgctggaaccccttggcc
acaaaagtcaaggtgttgaacatggcggagatccagacacgcctggcctacgtgtgctgc
gtccggcagctggagatggtgaagaacagtgagtactgtgagtacctgcgtccccccatc
gacagctacggcactctggacttcggcaagttcaacgagatttgcgaagtggggtaccag
catgggcggaccgtgtttgacatctggggtcggagtggtgtgttggaaaagatgctacag
gaccgacaggggacaagcaagatgaaggcatgtgatgtcctcacctgccccaacgcctcc
ttcactgaccttgccgagattgtgtcacgcattgagcccgccaaggtagccacggtggac
gacgagtctgactaccagaccgagtacgaggaggagctgccagatggccccaaggatgcc
tatgctgacttccagagtgccccggcccacgtgggctcggactcggaggacgagtcctca
cttcggcaccggaaccccagtctgngcttcccagagctgcccccggactcctcctacccc
tag

DBGET integrated database retrieval system