KEGG   Ailuropoda melanoleuca (giant panda): 100467918Help
Entry
100467918         CDS       T01329                                 

Definition
histone-lysine N-methyltransferase SETMAR-like
Orthology
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100467918
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100467918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 372 aa AA seqDB search
MAATEEGPETPTERLDVARGLENVPVSAWPPGAEPEPFQYTPDHVGGPGTDVDPTQITFP
GCICLKTPCLPGTCSCLRHGENYDDNSRLRDIGSEGKCAKPVFECNVLCQCGDHCRNRVV
QQGLQFQLQVFKTDKKGWGLRTLELIPKGRFVCEYAGEVLGYAEVQRRIQLQTVHDPNYI
IAIREHVYNGQVMETFVDPAYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIL
PEEELSYDYSGRFLNLMDSEDKERLDHGKIRKPCYCGAKSCAAFLPYDSSLFCPLEKPDV
SXEQKAREEHIRPLSVGESEKELNLSGSAPSQILSFKQFSLQGHMRPESFATKIGPTAYA
REYFSNGQPGML
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgactgaggaggggcctgagacccctactgagcggctggatgtcgcgcgcggc
ttggagaacgtgcctgtgagcgcgtggcccccgggggcggagccagagcccttccagtat
actcctgaccatgtaggtggacctggaacagatgttgatcccacacaaataacctttccc
ggatgtatttgcctcaagactccctgcctccctggtacttgctcctgtctccgtcatggg
gagaactatgatgataattcacgccttagagatataggatcggaaggaaagtgtgccaag
ccagtttttgaatgcaacgtcctgtgccagtgcggtgaccactgcaggaacagagtggtc
cagcagggtctgcagttccaactccaggtgttcaagacggacaaaaaaggctggggactt
cgtaccttggaactgataccaaaaggacggtttgtctgtgaatatgctggtgaagttttg
ggatatgctgaagtacagagaagaattcagttacaaacagtgcacgatccaaattacatt
atagccatcagagaacatgtgtacaacgggcaggtaatggaaacatttgttgatcctgcc
tatattggaaatattggaagatttctcaatcattcttgcgagccaaacctgctaatgatt
cctgtccgaattgactcaatggtaccaaagttggcactttttgcagccaaagatattttg
cctgaagaagaactctcttatgactattcgggaagatttctgaatctaatggacagtgaa
gacaaagaaaggctagatcatgggaaaataagaaaaccttgttattgtggtgccaaatca
tgtgctgctttcctgccttatgacagttcgctgttctgccccttagaaaagccagacgtc
agttaggagcaaaaagcacgggaggaacacattaggcctctctcagtgggtgagagtgag
aaggaactgaacttgtctggctcagccccttcccagatcctctctttcaagcagtttagc
ctccaggggcacatgagaccggagtcatttgccaccaagattggaccaactgcatacgcc
agggaatatttcagcaacggacaaccaggaatgctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system