KEGG   Ailuropoda melanoleuca (giant panda): 100467979Help
Entry
100467979         CDS       T01329                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:aml00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 724 aa AA seqDB search
MLGFLKRPVVVTADINLNVVALTAMGLLSRLWQMGPRAVVFDEVYYGQYISFYMKRIFFL
DGSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALTGALSVPMAYQ
ILLELGFSHCAAMGAALLMLIENALITQSRLMLLESVLIFFNLLAVLSYLKFSNSQKQRP
FSLSWWFWLMLTGVACSCAVGVKYVGVFTYLLVLAVASVHAWHLIGDRTLSHIRVLCHLL
ARAAALLVVPALMYLLFFYVHLILVYRSGPHDQIMSSAFQASLEGGLARITQGQPLEVAY
GSQVTLKNVFGKPVPCWLHSHQSTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPGR
HQLVVGSPPRPVRHGDVVQLVHGMTTRFLNTHDVAAPLSPHSQEVSCYVDYNISMPSQNL
WRLDIVNRESDADVWKTILSEVRLVHVNTSAVLKLSGAHLPDWGFRQLEVVGEKLSRGYH
ESMVWNVEEHRYGKSQEQKERELELHSPAQMDFSRNLSFMARFLELQWRMLTVKSDGSEH
KYSSSPLDWVTLDTSIAYWLHPRTSAQIHLLGNVVIWASASLATVVYALLFFWYLLRRRR
GLRDLPEDSWLRWVLAGALCAGGWAVNYLPFFVMEKTLFLYHYLPALTFQILLLPVVLQH
VSDHLCRSPPLRSLFSALVVAWYSCACHVFITLRPLTYGDKSLSPSELKALRWKDSWDIL
IRKY
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatttttgaagcgccctgtcgtggtgacagctgacatcaatttgaatgttgtg
gctctgacggccatggggttactgagccgcctgtggcagatgggcccaagggctgtggtt
tttgatgaagtgtattatgggcagtacatctctttctacatgaagcggatcttctttctg
gatggcagtggaccaccatttggccatatgctgctggccttaggaggttacttaggagga
ttcgatggtaactttttgtggaacagaatcggagcagaatacagcagcaacgtgcccgtg
tggtctttgcgcctgctgccggccctgaccggggccctgtcggtgcccatggcctaccag
atcctgctggagctcggcttttctcattgcgctgccatgggggctgctctgctgatgctt
atcgagaacgctctcatcactcagtcaaggctcatgcttttggagtcagtgttaatattt
tttaatctgttggctgtgctgtcctacctgaagttctccaactcccaaaaacagaggccc
ttctctctgagctggtggttttggctgatgctgacgggagtggcctgctcctgtgcagtg
ggtgtcaaatacgtgggtgttttcacgtacctgctggtgctcgcggtcgccagcgtccat
gcctggcacctgatcggagaccggaccttgtcacacatccgtgtgctctgtcacctgctt
gcccgagctgcagccctgctggtcgtcccagccctcatgtacttgctgttcttctatgtc
cacttgattctggtctaccgctccgggccccacgatcagatcatgtccagtgctttccaa
gccagcctggagggagggctagctcggatcacgcagggccagcccctggaggtggcctac
ggttcccaggtcactctgaagaacgtctttggcaaacctgtgccctgctggcttcattcc
caccagagcacctaccccatgatatacgagaacggccgaggcagctcgcaccagcagcag
gtgacctgttaccccttcaaagacgtcaacaactggtggattgtgaaggatcccgggagg
catcagctggtggtgggtagtcccccgaggcctgtgcggcatggggacgtggtgcagctg
gtacacggcatgaccacccgcttcctcaacacgcacgacgtggcagcacccctgagcccg
cactcgcaggaggtctcctgctacgtggactacaacatctccatgccctcccagaacctc
tggagactggacatcgtaaaccgcgaatccgacgcggacgtttggaagaccatcttgtca
gaggtgcgcctggtgcacgtgaacacctccgcggtcctcaagctgagcggggcccacctc
ccagactgggggttccggcagctggaggtcgttggggagaagctgtcccggggctaccac
gagagcatggtgtggaacgtggaggaacatcgatatggcaagagccaggagcagaaggag
agggagctggagctgcactcgcccgcgcagatggacttcagcagaaacctgagcttcatg
gccaggttcctggagctgcagtggaggatgctgacggtgaagagtgacggctcggagcac
aagtacagctcctcgccgctggactgggtcaccctggacaccagcatcgcctactggctg
caccccagaaccagtgctcagatccacctgcttgggaacgtcgtgatctgggcctcggcc
agcctcgccacggtggtctacgctctgctgttcttctggtacctgctgcggcgccgaagg
ggcctccgtgacctgcccgaggattcctggctgcgctgggtgctggccggggctctgtgc
gccggcggctgggcggtgaactacctccccttcttcgtgatggagaagacactcttcctc
taccactaccttcccgcgctcaccttccagatcctcctgctccccgtggtcctgcagcac
gtcagcgaccacctgtgcaggtccccacccctgaggagcctcttcagcgccctggttgtg
gcgtggtactcctgcgcctgtcacgtgttcatcacactgcgtccgctcacctacggggac
aagtcgctctcgcccagcgaactcaaggcccttcgctggaaagacagctgggacatcctg
atccgaaaatactag

DBGET integrated database retrieval system