KEGG   Ailuropoda melanoleuca (giant panda): 100467992Help
Entry
100467992         CDS       T01329                                 

Gene name
MYST3
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1702 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESSGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAVGHGRLLKDGPLYRLNTKATSVDGKE
SCESLSSLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITLSGQSASSSEEGYLERIDGLDFCRDSSVPLKFNKKTKGLIDGLTKFFTPSP
DGRKPRGEVVDYSEQYRIRKKGNRKSSTSDWPTDNQDGWDGKQESEERLFGSQEIMTEKD
MELFRDIQEQALQLYWNWISTFTSGIRLEERRAADGKALKQEAVSQQKVGVTGPPDPQVR
CPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPA
NEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCH
LVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLG
RLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDFRSDQFVII
RREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIVSNSVVSEEEEEEAEEGENEEPQCQER
ELETSVGKSASRENKEQDSYSSVESEKKPEVTAPASSTRLNKQVLPRDSLPANNQPSRRG
RWGRKNRKTQERFDDKDSKLLLEETSTPQEQYGECEEKSETSQEQYTESEEQLAASQEQP
SQDGKPDIPKRRLSEGVELWRGQLKKTPETLKCRLPEGNDRLPRRYSDGDRALLRGFSES
SEEEEEPESPRSSSPPILTKPTLKRKKPILHRRRRVRKRKHHNSSVVTETISETTEVLDE
PFEDSDSERPMPRLEPTFEIDEEEEEEDESELFSRGYFHRLSSQDVLRCRPSSKRKSKDE
DDDEESDDADDTPILKPVSLLRKCDVKDSQLEPDTSTPMKKKKGWPKGKSRKPIHWKKRP
GRKPGFKLNREIIPVSTQECIVEPIVPIPKSGRKARLQENEDAVEPKEDLPLTEDRKEEV
DVHVEADEAEEGEDDTASSEVRAASPADSNSPETGTKEPEIEEEEEKARALEEQRQSEEE
QPELEEQEQEEEDEAAVETNQNEDQDADDEDDGHLGSSKKKELEEQPGREDVKEEPGGQE
SFLDTNVQSSRENIKDKDETEPDSEEEQTSHETSMVSEHMPGSEDDHEEDSNSKEELIEL
KEEEEIPHSELDLETVQAVQSLTQEESNEHEGAYQDCEETLAACQTLQSYTQADEDPQMS
MVEDCHASGHNSPISSVQSHPSQSVRSVNSPNVPALESGYTQISPEQGSLSAPSMQNMET
SPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNSSSQSSCSY
GGLSSSSSLTQNSCVVTQQMASMGNSCSMMQQSSVPPAAANCSIKSPQSCVVERPPSNQX
XXXXSRSPRRRRSSSRRCRSAA
NT seq 5109 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgctaacccgctgtatacggagtggattttggaggccatcaaaaaagtg
aagaagcaaaaacagcgtccttcagaagaaaggatatgcaatgcagtgtcttcatcccat
ggcttggatcgtaaaactgttttagaacaattggagttgagtgttaaagatggaacaatt
ttaaaagtctccaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaaaccccgaaaccatggaaaattggataataaacaaaatgtagattggaat
aaactgatcaagcgggcggttgagggcttggcagagtccagtggctcaactttgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcgttatttggaggcagtgctgcc
tctggctttcaccagcagttacgattggctattaaacgagccgttggccacggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaaccagtgtggatgggaaagag
agttgtgagtctctttcatctttacctccagtgtcactccttccacatgaaaaggataag
cctgttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaaccga
gaaaagaagccagaggaactcatctcctgtgcggactgtggcaacagtggtcatccatcc
tgtttaaagttttcccctgaactaacggttagagtgaaggccttacggtggcagtgcatt
gagtgtaaaacgtgcagctcctgtcgagatcaaggcaaaaatgcagataacatgctcttt
tgtgattcctgtgaccgaggttttcacatggagtgttgtgatccgccactcacccggatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaaaggacggaaacttctg
cagaagaaggcagcacagataaaacggcgctatgctaacccaataggacgtccgaaaaac
aggttaaagaaacaaaacacggtatcaaaaggccccttcagcaaagttcgaactggtcca
ggaaggggccggaaacgtaaaatcactctttctggtcaatcagcatcgtcatcagaagaa
ggatatttagagcgaatagatggtttggacttctgcagagatagcagtgtccccttgaag
ttcaacaagaaaaccaaagggctcattgatggccttaccaaattcttcaccccttccccc
gatgggcggaaacctcgaggggaagtggtagactactctgagcaatatagaatcaggaaa
aagggcaacagaaaatcaagcacttcagattggcccacagacaatcaggatggctgggat
ggcaaacaagaaagtgaggaacggctttttgggagccaggaaatcatgactgagaaagat
atggaattatttcgtgatatccaagaacaagcactgcagttatactggaactggatatcc
acttttacatcaggcatccgcctggaagagcgacgggcagctgatgggaaagctctcaaa
caagaggcagtatctcagcagaaagttggagtaactggtccgcctgatccacaagtccgc
tgtccctctgtcattgagtttgggaagtatgaaattcacacctggtactcctccccatat
cctcaagaatactcaaggttgcctaaattgtatctttgtgaattctgtctaaaatatatg
aaaagtagaactattctccagcagcacatgaagaaatgtggttggttccatcctcctgcc
aatgagatttacagaaaaaataatatttccgtctttgaggttgatgggaatgtgagtacc
atttattgtcagaacctgtgtctcttggcaaagttgtttcttgaccacaaaacactctat
tatgacgtggagccatttcttttttatgtactaacacagaatgatgtcaagggctgccac
cttgttggctacttttctaaagaaaagcactgccaacagaagtacaacgtttcctgcata
atgattcttccccaataccagcgtaagggctatggcaggtttctcatcgatttcagttat
ttgttatcaaagcgcgaaggccaagcagggtctccagagaaaccgttatccgatctaggt
cgtctttcctacatggcttactggaaaagtgtaatattggagtgcctttatcaccaaaat
gacaagcaaatcagcattaagaagttaagcaagttgactggaatctgccctcaagacatt
acttccacactccaccacctacgaatgctggactttcgtagtgaccaatttgtgataatc
cgccgggaaaaacttatccaggatcacatggcaaagcttcagctgaatttgcgacctgtg
gatgtagatccagaatgtttgcgctggactcctgtcatagtctccaattctgttgtctca
gaggaggaggaagaggaggctgaggaaggagaaaacgaagagcctcagtgccaggaaaga
gaattagagacaagtgtgggaaagtctgcatctcgggagaacaaagaacaagattcttat
tcttcagtagaaagtgaaaagaaaccagaagttacggcaccagccagttctacacgtctg
aacaaacaagtccttccccgtgatagtcttcctgcaaataatcagccatcccggagaggc
cgctgggggaggaagaacaggaaaacccaggaacgttttgatgataaagattctaaactg
ctcttggaagagacatcaactcctcaggaacaatatggagaatgtgaggaaaaatcagaa
acctcccaagaacaatacactgaaagtgaggagcagttggcagcctctcaggagcagcca
agccaggatggaaagccagacattcccaaaagaagactaagtgagggggttgagctctgg
cgaggacagctgaagaagacccccgagacactgaagtgtagattaccagaaggcaatgat
aggctgccccgtcgctatagtgatggtgacagggctctcctcagaggcttcagtgagagt
agtgaggaggaagaagagccagaaagtcctcggtccagctccccaccaattcttacaaag
cccacattgaagagaaaaaaacccattcttcaccgaaggcggagagtccgaaagcgcaaa
caccacaatagcagtgtggtcacagagactatttctgagacgacagaggtgttagatgaa
ccttttgaagactctgactccgagaggccgatgccaagattagaacccacgtttgagatc
gatgaagaggaagaggaagaggatgaaagcgaactcttctccagagggtacttccaccgt
ctctcctcacaggatgtgctcaggtgtcgaccctcttctaagaggaaatcgaaagatgaa
gatgacgatgaagagtcagatgacgccgatgacactcctatcctaaagccagtatctctc
ttgagaaaatgtgatgtgaaggattctcagcttgagccagatacatccacacctatgaaa
aagaaaaagggatggcccaaaggcaaaagccgcaaaccaatccactggaagaaaagacct
ggtcgcaaaccaggattcaagttgaatcgggaaattatacctgtttctactcaagaatgc
attgttgagcccattgtccccattcctaaatcaggacgtaaagccagacttcaagagaat
gaagacgctgtcgaaccaaaagaagacttgcctctaactgaagacaggaaggaagaagtg
gacgtgcacgtggaagcagacgaggctgaagagggagaagacgacacagccagcagtgaa
gtcagagcggcttctccggcggacagcaacagccctgagacagggacaaaagaacctgag
atagaagaggaggaggagaaggcccgggccttagaggagcagaggcagtcagaagaggag
caaccagaactggaagaacaggagcaggaggaagaggatgaagcggctgtagagacaaac
cagaatgaagaccaggatgcagatgatgaagatgatggtcacctgggatctagcaagaaa
aaagagctggaggagcagcccggtagggaagacgtcaaggaggagcccggtggtcaggag
tcttttttagatactaacgtgcagagcagtagggagaatataaaggataaagatgaaaca
gaaccagattcggaagaggaacagacttcccatgagacatccatggtatcagagcatatg
cccgggtctgaggacgaccatgaggaagattcaaactctaaggaagaattgattgagctg
aaagaggaagaagagattcctcatagtgaactggatctggaaaccgtgcaggcagtgcag
tctctgactcaagaagaaagcaacgagcacgagggagcctaccaggactgtgaagagact
ctggcggcgtgtcagaccctgcagagttacacccaggcggacgaagaccctcagatgtcc
atggtcgaagactgccatgcctcgggacataatagtccaatatcttctgttcagtctcat
cccagccagtcggtccgctcagtcaatagtcccaacgtgcctgccctcgaaagtggttac
acccagatcagcccggagcaaggatccctgtccgcaccctctatgcagaacatggagacc
agccccatgatggatgtgccttccgtatcagaccactctcagcaggtggtggacagtggc
ttcagtgacctgggcagcatagagagcaccaccgagaactatgagaaccccagcagttac
gattctacgatgggcggcagcatctgcgggaatagctcctcgcagagcagctgctcctac
ggcggcttgtcatcctccagcagcctcacccagaacagctgtgtcgtcactcagcaaatg
gccagcatgggcaacagctgcagcatgatgcagcagagcagcgtgccgcccgccgcggcc
aactgcagcatcaagtcgccgcagagctgcgtggtggagaggcctcccagtaaccagcan
nnnnnnnnnnnnagccgcagcccccgccgccgccgcagcagcagccgccgctgtcgcagt
gcagcatga

DBGET integrated database retrieval system