KEGG   Ailuropoda melanoleuca (giant panda): 100467992Help
Entry
100467992         CDS       T01329                                 

Gene name
KAT6A, MYST3
Definition
(RefSeq) K(lysine) acetyltransferase 6A
  KO
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    100467992 (KAT6A)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100467992 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1950 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESSGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAVGHGRLLKDGPLYRLNTKATSVDGKE
SCESLSSLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITLSGQSASSSEEGYLERIDGLDFCRDSSVPLKFNKKTKGLIDGLTKFFTPSP
DGRKPRGEVVDYSEQYRIRKKGNRKSSTSDWPTDNQDGWDGKQESEERLFGSQEIMTEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTG
ICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIV
SNSVVSEEEEEEAEEGENEEPQCQERELETSVGKSASRENKEQDSYSSVESEKKPEVTAP
ASSTRLNKQVLPRDSLPANNQPSRRGRWGRKNRKTQERFDDKDSKLLLEETSTPQEQYGE
CEEKSETSQEQYTESEEQLAASQEQPSQDGKPDIPKRRLSEGVELWRGQLKKTPETLKCR
LPEGNDRLPRRYSDGDRALLRGFSESSEEEEEPESPRSSSPPILTKPTLKRKKPILHRRR
RVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDESELFS
RGYFHRLSSQDVLRCRPSSKRKSKDEDDDEESDDADDTPILKPVSLLRKCDVKDSQLEPD
TSTPMKKKKGWPKGKSRKPIHWKKRPGRKPGFKLNREIIPVSTQECIVEPIVPIPKSGRK
ARLQENEDAVEPKEDLPLTEDRKEEVDVHVEADEAEEGEDDTASSEVRAASPADSNSPET
GTKEPEIEEEEEKARALEEQRQSEEEQPELEEQEQEEEDEAAVETNQNEDQDADDEDDGH
LGSSKKKELEEQPGREDVKEEPGGQESFLDTNVQSSRENIKDKDETEPDSEEEQTSHETS
MVSEHMPGSEDDHEEDSNSKEELIELKEEEEIPHSELDLETVQAVQSLTQEESNEHEGAY
QDCEETLAACQTLQSYTQADEDPQMSMVEDCHASGHNSPISSVQSHPSQSVRSVNSPNVP
ALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENY
ENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLTQNSCVVTQQMASMGNSCSMMQQSS
VPPAAANCSIKSPQSCVVERPPSNQQPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYER
IPGDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQL
APSHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGH
ISIRSKSAPLPSAAAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSM
NMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHG
NMMYTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 5853 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgctaacccgctgtatacggagtggattttggaggccatcaaaaaagtg
aagaagcaaaaacagcgtccttcagaagaaaggatatgcaatgcagtgtcttcatcccat
ggcttggatcgtaaaactgttttagaacaattggagttgagtgttaaagatggaacaatt
ttaaaagtctccaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaaaccccgaaaccatggaaaattggataataaacaaaatgtagattggaat
aaactgatcaagcgggcggttgagggcttggcagagtccagtggctcaactttgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcgttatttggaggcagtgctgcc
tctggctttcaccagcagttacgattggctattaaacgagccgttggccacggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaaccagtgtggatgggaaagag
agttgtgagtctctttcatctttacctccagtgtcactccttccacatgaaaaggataag
cctgttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaaccga
gaaaagaagccagaggaactcatctcctgtgcggactgtggcaacagtggtcatccatcc
tgtttaaagttttcccctgaactaacggttagagtgaaggccttacggtggcagtgcatt
gagtgtaaaacgtgcagctcctgtcgagatcaaggcaaaaatgcagataacatgctcttt
tgtgattcctgtgaccgaggttttcacatggagtgttgtgatccgccactcacccggatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaaaggacggaaacttctg
cagaagaaggcagcacagataaaacggcgctatgctaacccaataggacgtccgaaaaac
aggttaaagaaacaaaacacggtatcaaaaggccccttcagcaaagttcgaactggtcca
ggaaggggccggaaacgtaaaatcactctttctggtcaatcagcatcgtcatcagaagaa
ggatatttagagcgaatagatggtttggacttctgcagagatagcagtgtccccttgaag
ttcaacaagaaaaccaaagggctcattgatggccttaccaaattcttcaccccttccccc
gatgggcggaaacctcgaggggaagtggtagactactctgagcaatatagaatcaggaaa
aagggcaacagaaaatcaagcacttcagattggcccacagacaatcaggatggctgggat
ggcaaacaagaaagtgaggaacggctttttgggagccaggaaatcatgactgagaaagat
atggaattatttcgtgatatccaagaacaagcactgcagaaagttggagtaactggtccg
cctgatccacaagtccgctgtccctctgtcattgagtttgggaagtatgaaattcacacc
tggtactcctccccatatcctcaagaatactcaaggttgcctaaattgtatctttgtgaa
ttctgtctaaaatatatgaaaagtagaactattctccagcagcacatgaagaaatgtggt
tggttccatcctcctgccaatgagatttacagaaaaaataatatttccgtctttgaggtt
gatgggaatgtgagtaccatttattgtcagaacctgtgtctcttggcaaagttgtttctt
gaccacaaaacactctattatgacgtggagccatttcttttttatgtactaacacagaat
gatgtcaagggctgccaccttgttggctacttttctaaagaaaagcactgccaacagaag
tacaacgtttcctgcataatgattcttccccaataccagcgtaagggctatggcaggttt
ctcatcgatttcagttatttgttatcaaagcgcgaaggccaagcagggtctccagagaaa
ccgttatccgatctaggtcgtctttcctacatggcttactggaaaagtgtaatattggag
tgcctttatcaccaaaatgacaagcaaatcagcattaagaagttaagcaagttgactgga
atctgccctcaagacattacttccacactccaccacctacgaatgctggactttcgtagt
gaccaatttgtgataatccgccgggaaaaacttatccaggatcacatggcaaagcttcag
ctgaatttgcgacctgtggatgtagatccagaatgtttgcgctggactcctgtcatagtc
tccaattctgttgtctcagaggaggaggaagaggaggctgaggaaggagaaaacgaagag
cctcagtgccaggaaagagaattagagacaagtgtgggaaagtctgcatctcgggagaac
aaagaacaagattcttattcttcagtagaaagtgaaaagaaaccagaagttacggcacca
gccagttctacacgtctgaacaaacaagtccttccccgtgatagtcttcctgcaaataat
cagccatcccggagaggccgctgggggaggaagaacaggaaaacccaggaacgttttgat
gataaagattctaaactgctcttggaagagacatcaactcctcaggaacaatatggagaa
tgtgaggaaaaatcagaaacctcccaagaacaatacactgaaagtgaggagcagttggca
gcctctcaggagcagccaagccaggatggaaagccagacattcccaaaagaagactaagt
gagggggttgagctctggcgaggacagctgaagaagacccccgagacactgaagtgtaga
ttaccagaaggcaatgataggctgccccgtcgctatagtgatggtgacagggctctcctc
agaggcttcagtgagagtagtgaggaggaagaagagccagaaagtcctcggtccagctcc
ccaccaattcttacaaagcccacattgaagagaaaaaaacccattcttcaccgaaggcgg
agagtccgaaagcgcaaacaccacaatagcagtgtggtcacagagactatttctgagacg
acagaggtgttagatgaaccttttgaagactctgactccgagaggccgatgccaagatta
gaacccacgtttgagatcgatgaagaggaagaggaagaggatgaaagcgaactcttctcc
agagggtacttccaccgtctctcctcacaggatgtgctcaggtgtcgaccctcttctaag
aggaaatcgaaagatgaagatgacgatgaagagtcagatgacgccgatgacactcctatc
ctaaagccagtatctctcttgagaaaatgtgatgtgaaggattctcagcttgagccagat
acatccacacctatgaaaaagaaaaagggatggcccaaaggcaaaagccgcaaaccaatc
cactggaagaaaagacctggtcgcaaaccaggattcaagttgaatcgggaaattatacct
gtttctactcaagaatgcattgttgagcccattgtccccattcctaaatcaggacgtaaa
gccagacttcaagagaatgaagacgctgtcgaaccaaaagaagacttgcctctaactgaa
gacaggaaggaagaagtggacgtgcacgtggaagcagacgaggctgaagagggagaagac
gacacagccagcagtgaagtcagagcggcttctccggcggacagcaacagccctgagaca
gggacaaaagaacctgagatagaagaggaggaggagaaggcccgggccttagaggagcag
aggcagtcagaagaggagcaaccagaactggaagaacaggagcaggaggaagaggatgaa
gcggctgtagagacaaaccagaatgaagaccaggatgcagatgatgaagatgatggtcac
ctgggatctagcaagaaaaaagagctggaggagcagcccggtagggaagacgtcaaggag
gagcccggtggtcaggagtcttttttagatactaacgtgcagagcagtagggagaatata
aaggataaagatgaaacagaaccagattcggaagaggaacagacttcccatgagacatcc
atggtatcagagcatatgcccgggtctgaggacgaccatgaggaagattcaaactctaag
gaagaattgattgagctgaaagaggaagaagagattcctcatagtgaactggatctggaa
accgtgcaggcagtgcagtctctgactcaagaagaaagcaacgagcacgagggagcctac
caggactgtgaagagactctggcggcgtgtcagaccctgcagagttacacccaggcggac
gaagaccctcagatgtccatggtcgaagactgccatgcctcgggacataatagtccaata
tcttctgttcagtctcatcccagccagtcggtccgctcagtcaatagtcccaacgtgcct
gccctcgaaagtggttacacccagatcagcccggagcaaggatccctgtccgcaccctct
atgcagaacatggagaccagccccatgatggatgtgccttccgtatcagaccactctcag
caggtggtggacagtggcttcagtgacctgggcagcatagagagcaccaccgagaactat
gagaaccccagcagttacgattctacgatgggcggcagcatctgcgggaatagctcctcg
cagagcagctgctcctacggcggcttgtcatcctccagcagcctcacccagaacagctgt
gtcgtcactcagcaaatggccagcatgggcaacagctgcagcatgatgcagcagagcagc
gtgccgcccgccgcggccaactgcagcatcaagtcgccgcagagctgcgtggtggagagg
cctcccagtaaccagcagccgctgtcgcagtgcagcatgaacaacagcttcaccccagcg
cccatgatcatggagatcccggagtcgggaagcactgggaacataagtatttatgagagg
attccgggggacttcggtgccggcagctactctcagccgtcagccaccttcagtctagcc
aagttgcagcagctgacgaacaccattatggaccctcatgccatgccttatagccattct
cctgccgtgacttcctatgcaaccagtgtttctttgtctaacacaggactggcccagctg
gctccatctcacccattagctgggacccctcaagcacaagccaccatgacgccgcccccg
aacttggcctccaccaccatgaacctcacgtcccctctgctccagtgcaacatgtctgcc
accaacattggcattcctcacacccagaggttgcaagggcaaatgccggtcaaggggcac
atttccatccgctccaagtccgcgccactgccctctgcggctgcccatcagcagcagctg
tacggccgcagcccccctgcggtggccatgcaggccggccctcgtgccctggctgtgcag
cgtggcatgaacatgggggttaatttgatgccgacccccgcctataatgtcaattccatg
aatatgaacaccttgaacgccatgaacagctatcgaatgacacaacccatgatgaacagc
agttaccatagtaaccctgcctacatgaaccagacagcacagtatcctatgcagatgcag
atggggatgatggggagccaggcctatacccagcagcctatgcagccaaaccctcatgga
aacatgatgtacactggcccctcccatcacagctacatgaatgctgctggcgtgcccaag
cagtcactcaatggaccttacatgagaagatga

DBGET integrated database retrieval system