KEGG   Ailuropoda melanoleuca (giant panda): 100468253Help
Entry
100468253         CDS       T01329                                 

Gene name
CLK4
Definition
CDC-like kinase 4
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 481 aa AA seqDB search
MRHSKRTHCPDWDSRESWGHESYSGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEAR
SLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDVESGYRVHCSKSSVRSRRSSPKRKRNRH
CSSHQSRSKSHRRKRSRSIEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHG
MDGIHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPTHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPVKRITLDEALQHPFFDLLNK
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcggcattccaaaagaactcactgtcctgattgggatagcagagaaagctggggacat
gaaagctacagtggaagtcacaaacggaagaggaggtcccacagtagtacccaagagaac
agacattgtaaaccacatcaccagtttaaagaatctgattgtcattacttagaagcgagg
tccttgaatgagagagattatcgggaccggagatacgttgatgaatacagaaatgactac
tgcgaaggctatgtccctagacattatcacagagacgttgaaagcggctatcgagtccac
tgcagtaaatcttcggtccgaagcaggagaagcagccctaaaaggaagcgtaatagacac
tgttcaagtcatcagtcacgttcgaagagccaccgaaggaaaagatccaggagtatagag
gatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaagatatgaa
atcgtggacactttgggtgaaggggcctttggcaaagtcgtggagtgcattgatcatggc
atggatggcatacacgtagcagtgaaaattgtaaaaaatgtaggtcgataccgtgaagca
gctcgttcagaaatccaagtattggagcatttaaatagtactgatcccaatagtgtcttc
cgatgtgtccagatgctagaatggtttgatcatcatggtcatgtttgtattgtgtttgaa
ctactgggacttagtacctatgatttcattaaagaaaatagctttctaccatttcaaatt
gaccacatcaggcagatggcatatcagatctgccagtctataaattttttgcatcataat
aaattaacccatacagatttgaagcctgaaaatattttatttgtgaagtctgactatgta
gtcaaatataattctaaaatgaaacgcgatgaacgcacactgaaaaacacagatatcaaa
gttgttgactttggaagtgcgacgtacgatgatgaacatcatagcactttggtatctacg
cggcattacagagctccagaggtcattctggctttaggttggtcccagccttgcgatgtg
tggagtataggctgcattctcatcgaatattacctcggtttcacagtctttcagactcac
gatagtaaagagcacctggcaatgatggaacgaatattaggacccataccaacacacatg
attcagaaaaccagaaaacgcaagtatttccaccataaccagctagactgggatgaacac
agttccgctggccgatacgttaggagacgctgcaaaccattaaaggaatttatgctctgt
catgatgaagaacatgagaaactgtttgacctggtacgcagaatgttagaatacgaccca
gtgaaaagaatcaccttggacgaagccttgcagcatcccttctttgacttattaaacaag
aaatga

DBGET integrated database retrieval system