KEGG   Ailuropoda melanoleuca (giant panda): 100468286Help
Entry
100468286         CDS       T01329                                 

Gene name
MAP2K5
Definition
(RefSeq) mitogen-activated protein kinase kinase 5
  KO
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100468286 (MAP2K5)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100468286 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100468286 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    100468286 (MAP2K5)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100468286 (MAP2K5)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100468286 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 448 aa AA seqDB search
MLWLALGPFHAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHGSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAIAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEDLMGHPFIM
QFNDGNATVVSMWVCRALEERRSQQGPP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctggcccttggccccttccatgccatggagaaccaggtgctggtgattcgt
atcaagattccaaatagtggcgcagtggactggacagtgcactccggaccgcagttactc
ttcagggatgtgctggatgtgataggccaggttctgcctgaagcaacaaccacagcattt
gaatatgaagatgaagatggtgaccgaattacagtgaggagcgatgaagaaatgaaggcc
atgctgtcctattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacccgggctggaccctctcaacacggcagcccagcggtctccgactcactt
ccaagcaatagcttaaagaagtcttctgccgaactgaaaaaaatattagccaatggccag
atgaatgaacaagacatacggtatcgagacactcttggccatggcaacggaggcacagtc
tacaaagcatatcatgtcccgagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcatatatcatagggttttatggtgcatttttcgtagaaaacaggatttcaatatgt
acagaattcatggatgggggatccttggatgtatatagaaaaattccagagcatgtcctt
ggaagaattgcaatagcagttgttaaaggtcttacctatttgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctagtaaacacaagaggacaggtcaagctgtgc
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaagaatttcaggggagcagtatggaatccattctgatgtctgg
agtttaggaatctctttcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccggttggagagttctccgagccatttgtacatttcatcactcagtgcatg
cgaaaacaaccaaaagaaagaccagcacctgaggacctgatgggccacccgttcatcatg
cagttcaatgacggaaacgccaccgtggtgtccatgtgggtgtgcagggcgctggaggag
aggcgcagccagcaggggcctccgtga

DBGET integrated database retrieval system