KEGG   Ailuropoda melanoleuca (giant panda): 100468286Help
Entry
100468286         CDS       T01329                                 

Gene name
MAP2K5
Definition
mitogen-activated protein kinase kinase 5
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100468286 (MAP2K5)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100468286 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100468286 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    100468286 (MAP2K5)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100468286 (MAP2K5)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100468286 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 448 aa AA seqDB search
MLWLALGPFHAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHGSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAIAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEDLMGHPFIM
QFNDGNATVVSMWVCRALEERRSQQGPP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctggcccttggccccttccatgccatggagaaccaggtgctggtgattcgt
atcaagattccaaatagtggcgcagtggactggacagtgcactccggaccgcagttactc
ttcagggatgtgctggatgtgataggccaggttctgcctgaagcaacaaccacagcattt
gaatatgaagatgaagatggtgaccgaattacagtgaggagcgatgaagaaatgaaggcc
atgctgtcctattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacccgggctggaccctctcaacacggcagcccagcggtctccgactcactt
ccaagcaatagcttaaagaagtcttctgccgaactgaaaaaaatattagccaatggccag
atgaatgaacaagacatacggtatcgagacactcttggccatggcaacggaggcacagtc
tacaaagcatatcatgtcccgagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcatatatcatagggttttatggtgcatttttcgtagaaaacaggatttcaatatgt
acagaattcatggatgggggatccttggatgtatatagaaaaattccagagcatgtcctt
ggaagaattgcaatagcagttgttaaaggtcttacctatttgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctagtaaacacaagaggacaggtcaagctgtgc
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaagaatttcaggggagcagtatggaatccattctgatgtctgg
agtttaggaatctctttcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccggttggagagttctccgagccatttgtacatttcatcactcagtgcatg
cgaaaacaaccaaaagaaagaccagcacctgaggacctgatgggccacccgttcatcatg
cagttcaatgacggaaacgccaccgtggtgtccatgtgggtgtgcagggcgctggaggag
aggcgcagccagcaggggcctccgtga

DBGET integrated database retrieval system