KEGG   Ailuropoda melanoleuca (giant panda): 100468407Help
Entry
100468407         CDS       T01329                                 

Definition
calpain-1 catalytic subunit-like
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:aml04141]
Cellular Processes; Cell growth and death; Apoptosis [PATH:aml04210]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:aml05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 715 aa AA seqDB search
MAEEIITPVYCTGVSAQVQKQRAKELGLGRHENAIKYMGQDYEQLRAHCLQSGALFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVSLIRMRNPWGE
VEWTGAWSDGSSEWNSVDPYEREQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RSIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDADDDYGGRESGCSF
VLALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQSAVHLKRDFFLANSSRARSEQFIN
LREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTQELDDQIQANLPDEQVLS
EEEIDENFKALFRQLAGEDMEISVKELQTILNRIISKHKDLRTKGFSLESCRSMVNLMDR
DGNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELI
ITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggagatcatcacccccgtgtactgcacgggggtgtccgcacaagtgcagaag
cagcgggccaaggagctgggccttggccgccatgaaaacgccatcaagtacatgggccag
gactatgagcagctgcgggctcattgcctgcagagtggggccctcttccgtgatgaggct
ttccccccggtgccccagagcctaggctacaaggacctgggccccaactcctccaaaacc
tatggcatcaagtggaaacgtcccacggagctgctctcaaacccccagttcattgtggat
ggagccacccgcacagacatctgccagggagcactgggggactgttggctcctggctgcc
attgcctccctcaccctcaatgacacgcttctgcatcgagtggtaccacacggccaaagc
ttccagaatggctatgccggcatcttccatttccagctgtggcagtttggggaatgggtg
gacgtggtcgtggatgacctgctgcccatcaaggacgggaagctggtgtttgtgcactcc
gcccaaggcaatgagttctggagtgccctgctcgagaaggcctatgccaaggtgaatggc
agctacgaggccctctctgggggcagtacttcagagggcttcgaggacttcacaggcggg
gtcactgagtggtatgagctgcgcaaggcacccagcgacctctaccaaatcatcctcaag
gccctggagcgggggtccctcctgggctgctccattgacatctccagcgttctggatatg
gaggccgtcaccttcaagaagctggtgaagggccatgcctactctgtgacaggggccaag
caggtgaactaccagggccagatggtgagcctgatccggatgcggaatccctggggcgag
gtggagtggacgggagcctggagtgacggctcctcggagtggaacagtgtggacccttac
gagcgggagcagctccgggtcaagatggaggatggagagttctggatgtccttccgagac
ttcatgcgtgagttcacccgcctggagatctgcaacctgacgcccgatgcgctcaagagc
cggtcgatccgcaaatggaacaccacactctatgaggggacctggcggcgggggagcacc
gcgggcggctgcaggaactacccagccaccttctgggtcaatccccagttcaagatccgg
ctggaggagaccgatgatgcggacgacgactacgggggtcgcgagtcaggctgcagcttc
gttctagccctcatgcagaagcaccgtcgccgggagcgccgctttggccgcgacatggag
accattggcttcgccgtctacgaggtccctccggagctggtgggccagtcggccgtgcac
ctgaagcgggacttcttcctggctaactcgtcgcgggcgcgctcggagcagttcatcaac
ctgcgtgaggtcagcacgcgcttccgcttgccgcccggggagtacgtggtggtgccctcc
actttcgagcccaacaaggagggggacttcgtgctgcgtttcttctccgagaagagcgcc
gggacccaggagctggatgaccagatccaggccaatctccccgatgagcaagtgctctca
gaagaggagatcgacgagaacttcaaggccctcttcaggcagctggccggggaggacatg
gagatcagcgtcaaggagctgcagaccatcctgaacaggatcatcagcaaacacaaggat
ctgcgtaccaagggcttcagcctggagtcgtgccgcagcatggtgaatctcatggaccgg
gacggcaacgggaagctgggcctggtggagttcaacatcctgtggaaccggatccggaat
tacctgtccatcttccggaagttcgacttggacaagtcgggcagcatgagtgcgtacgag
atgcggatggccatcgagtctgcaggcttcaagctcaacaagaagctctatgagctcatc
atcacccgctactcggagccggacctggccgtggacttcgacaacttcgtgtgttgcctg
gtgcggctggagaccatgttccggtttttcaaaactctggacacagatctggatggcgtc
gtgacctttgacttgtttaagtggttacagctgaccatgtttgcatga

DBGET integrated database retrieval system