KEGG   Ailuropoda melanoleuca (giant panda): 100468407Help
Entry
100468407         CDS       T01329                                 

Definition
calpain-1 catalytic subunit-like
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100468407
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100468407
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100468407
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     100468407
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C2: calpain family
   100468407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 715 aa AA seqDB search
MAEEIITPVYCTGVSAQVQKQRAKELGLGRHENAIKYMGQDYEQLRAHCLQSGALFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVSLIRMRNPWGE
VEWTGAWSDGSSEWNSVDPYEREQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RSIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDADDDYGGRESGCSF
VLALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQSAVHLKRDFFLANSSRARSEQFIN
LREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTQELDDQIQANLPDEQVLS
EEEIDENFKALFRQLAGEDMEISVKELQTILNRIISKHKDLRTKGFSLESCRSMVNLMDR
DGNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELI
ITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggagatcatcacccccgtgtactgcacgggggtgtccgcacaagtgcagaag
cagcgggccaaggagctgggccttggccgccatgaaaacgccatcaagtacatgggccag
gactatgagcagctgcgggctcattgcctgcagagtggggccctcttccgtgatgaggct
ttccccccggtgccccagagcctaggctacaaggacctgggccccaactcctccaaaacc
tatggcatcaagtggaaacgtcccacggagctgctctcaaacccccagttcattgtggat
ggagccacccgcacagacatctgccagggagcactgggggactgttggctcctggctgcc
attgcctccctcaccctcaatgacacgcttctgcatcgagtggtaccacacggccaaagc
ttccagaatggctatgccggcatcttccatttccagctgtggcagtttggggaatgggtg
gacgtggtcgtggatgacctgctgcccatcaaggacgggaagctggtgtttgtgcactcc
gcccaaggcaatgagttctggagtgccctgctcgagaaggcctatgccaaggtgaatggc
agctacgaggccctctctgggggcagtacttcagagggcttcgaggacttcacaggcggg
gtcactgagtggtatgagctgcgcaaggcacccagcgacctctaccaaatcatcctcaag
gccctggagcgggggtccctcctgggctgctccattgacatctccagcgttctggatatg
gaggccgtcaccttcaagaagctggtgaagggccatgcctactctgtgacaggggccaag
caggtgaactaccagggccagatggtgagcctgatccggatgcggaatccctggggcgag
gtggagtggacgggagcctggagtgacggctcctcggagtggaacagtgtggacccttac
gagcgggagcagctccgggtcaagatggaggatggagagttctggatgtccttccgagac
ttcatgcgtgagttcacccgcctggagatctgcaacctgacgcccgatgcgctcaagagc
cggtcgatccgcaaatggaacaccacactctatgaggggacctggcggcgggggagcacc
gcgggcggctgcaggaactacccagccaccttctgggtcaatccccagttcaagatccgg
ctggaggagaccgatgatgcggacgacgactacgggggtcgcgagtcaggctgcagcttc
gttctagccctcatgcagaagcaccgtcgccgggagcgccgctttggccgcgacatggag
accattggcttcgccgtctacgaggtccctccggagctggtgggccagtcggccgtgcac
ctgaagcgggacttcttcctggctaactcgtcgcgggcgcgctcggagcagttcatcaac
ctgcgtgaggtcagcacgcgcttccgcttgccgcccggggagtacgtggtggtgccctcc
actttcgagcccaacaaggagggggacttcgtgctgcgtttcttctccgagaagagcgcc
gggacccaggagctggatgaccagatccaggccaatctccccgatgagcaagtgctctca
gaagaggagatcgacgagaacttcaaggccctcttcaggcagctggccggggaggacatg
gagatcagcgtcaaggagctgcagaccatcctgaacaggatcatcagcaaacacaaggat
ctgcgtaccaagggcttcagcctggagtcgtgccgcagcatggtgaatctcatggaccgg
gacggcaacgggaagctgggcctggtggagttcaacatcctgtggaaccggatccggaat
tacctgtccatcttccggaagttcgacttggacaagtcgggcagcatgagtgcgtacgag
atgcggatggccatcgagtctgcaggcttcaagctcaacaagaagctctatgagctcatc
atcacccgctactcggagccggacctggccgtggacttcgacaacttcgtgtgttgcctg
gtgcggctggagaccatgttccggtttttcaaaactctggacacagatctggatggcgtc
gtgacctttgacttgtttaagtggttacagctgaccatgtttgcatga

DBGET integrated database retrieval system