KEGG   Ailuropoda melanoleuca (giant panda): 100468534Help
Entry
100468534         CDS       T01329                                 

Definition
cytochrome P450 2C23-like
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100468534
   00590 Arachidonic acid metabolism
    100468534
   00591 Linoleic acid metabolism
    100468534
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100468534
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100468534
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100468534
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100468534
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100468534
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP2 family
   100468534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 496 aa AA seqDB search
MALFSLPTLLVVYVAFLLFIFAWRRGNTRGLLLPPGPPPLPIIGNILQVKLWDLPTSLSR
LAEQHGPVYSLRLGPHPIVVLHGLQALKDALCGQAVNFGGRGRLPIMDNALRVYRLSFSH
GRRWEQMHQFTLTTLRNFGMGKRSMEERVQKEAQHLVRALAQTEAQPVDPAFILVCAPCN
IICSILFNEHFDYHDEEFLKLIRLLNENLSILSSFWVQLYSLWPSFIHYLPGRHQKVFKN
IQNIMDFILERVAQHQRTPKPVQPRDYTDCFIERMEEEKHDSYSEFNSENLAAVSLNLFS
AGTETVSRTLWLALLTLLKRPEVESRVHEEIDRVVGRDRVPCMKDRAQMPYTDAVVHEVQ
RCINLVPSNLPHVVIQETKFRQFFLPKGTTVFPLLSSVLYDSKEFANPQRFDPNHFLDKN
GNFRKSDFFIPFSIGKWACLGEGLARMEIFLFLTTTLQNFTLKPVVDQRELSTDPVYNGL
LRIIPASKLCFLPRPK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggctctattcagtctgcccaccctgctggtggtttacgtggctttcctgctgttcatc
tttgcgtggagaagaggaaacactcgtgggcttttgctgccacctggccctcctcctctt
cccatcattggcaatatcctgcaggtgaaactttgggacctgcccacctctctctccagg
ctggctgagcagcacggccctgtgtactcgctgcgtctgggcccccatccaatcgttgtg
cttcatggactccaggccctgaaggatgccctgtgtggtcaggcggtcaacttcggaggc
agagggaggctccccatcatggataatgccctcagagtatacagactttcattcagccat
ggcaggcggtgggagcaaatgcaccagttcactctcacgacgctgcggaactttgggatg
gggaagaggagcatggaggagcgcgtccagaaggaagcccagcacctggtgcgggccctc
gcacagacagaggctcagcctgtggaccctgccttcatcctcgtgtgtgctccctgcaac
attatctgctccatcctctttaacgagcacttcgactaccacgacgaggaattcctgaag
ctgattaggttactgaatgaaaacctttccatattgagctctttctgggtgcagctctac
agtttgtggccatcgttcattcactatcttcctgggagacaccagaaagtttttaaaaac
attcagaatataatggatttcattttggagagagtagcacagcaccaaaggaccccgaag
cctgtgcagccccgggactacaccgactgcttcatcgaaaggatggaggaggaaaaacac
gattcatattctgaatttaattcggagaacctagcagctgttagcttaaatctgttcagc
gctggcactgagacagtcagcaggacactgtggctggcactgctgaccctgctgaaacgc
ccagaggtggaaagcagagttcacgaggaaattgacagagtggtgggccgggaccgggtc
ccctgcatgaaggacagagcccagatgccctacacagatgccgtggtgcatgaggtccag
agatgcatcaatctcgtcccctccaatctgcctcatgttgtgattcaggaaaccaaattc
agacagttcttccttcctaagggcacaactgtgttcccattgctctcctctgtcttgtat
gacagtaaagagtttgcgaacccacaaaggtttgacccgaaccattttctggataaaaat
ggaaactttcggaagagtgacttcttcatccccttctctattggaaaatgggcatgtctt
ggagaaggtcttgcacgaatggagatatttttattcctgaccaccactctgcaaaatttt
accttaaagcctgttgttgatcaaagggaactgagcactgacccagtctataatgggtta
ttgagaattattccagcttccaaactctgcttcttacccagaccaaaataa

DBGET integrated database retrieval system