KEGG   Ailuropoda melanoleuca (giant panda): 100468612Help
Entry
100468612         CDS       T01329                                 

Gene name
USP12, USP12P1
Definition
(RefSeq) ubiquitin specific peptidase 12
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100468612 (USP12)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100468612 (USP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 250 aa AA seqDB search
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDSENNNSTPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagatgcccatgaattcttaaattacctactaaatacaattgctgatatttta
caagaagagagaaagcaggaaaaacaaaatggccgtttacctaatggtaatattgacagt
gagaacaacaacagcacaccagacccaacatgggttcatgagatttttcagggaacattg
acaaatgaaaccagatgtcttacttgtgaaactataagcagcaaagacgaagatttttta
gacctttctgttgacgtggaacaaaacacatcgatcactcactgcttaaggggtttcagc
aacacagaaactctgtgcagtgagtacaaatattactgtgaagaatgtcgcagcaaacag
gaagcacacaaacggatgaaagttaaaaaactgcccatgattctagctctacacctgaag
aggtttaaatacatggatcaacttcatcgatacacaaaactgtcttatcgggtagttttt
cctttagaacttcgtctgtttaacacatctggtgatgcaaccaatcctgacagaatgtac
gaccttgttgccgtggtggttcactgtggaagtggtcctaatcgaggacattacattgcg
atagttaagagtcacgatttttggttgttgtttgatgacgacattgtagaaaaaatagat
gcacaagctattgaagaattctacgggttgacatcagatatctcaaagaactctgagtct
ggttacatccttttctatcagtctcgggactga

DBGET integrated database retrieval system