KEGG   Ailuropoda melanoleuca (giant panda): 100468755Help
Entry
100468755         CDS       T01329                                 

Definition
histone acetyltransferase KAT2A-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100468755
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100468755
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100468755
  Infectious diseases
   05166 HTLV-I infection
    100468755
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100468755
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100468755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 843 aa AA seqDB search
MAEPSQASTPAPATQPRPLQSPTPAPTPTPAPSPASAPTPAPTPAPAPAPAAAPAGSTGT
GGPGVGSGGTGSGGDPARPGLSQQQRASQRKAQVRGLPRXXXXXXXXXXXXXLQVFCRQA
NETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLG
MVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQG
VLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTR
WLCYCHVPQSCDSLPRYETTHIFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILT
HFPKFLSMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPATVSAAVVPSAPIFSPTMGGG
SNSSLSLDSGGAEPMPGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLG
PETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRM
PKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHL
MNHLKEYHIKHNVLYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECE
LNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRET
GWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPID
LKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGL
IDK
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggcctcgaccccagctccggctacgcagccccgtccccttcag
tctccaacccctgccccaactccgactcctgcccccagcccggcttcagccccgactccg
gctcccactccggcaccagcccccgccccagctgcagcgccagccggcagcacagggact
gggggtcccggggtaggaagtggggggaccgggagcggaggggatccggctcgacctggt
ctgagccagcagcagcgcgccagccagaggaaggcgcaagtccgggggctgccgcgnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncttgcaagtcttctgccgccaggcc
aatgaaacctgtaagtgtaatggatggaaaaaccccaagccccccactgcaccccgcatg
gacctgcagcagccagctgccaacctgagcgagctgtgccgcagctgtgagcaccccttg
gctgaccacgtgtcccacctggagaatgtgtcagaggatgagattaaccgactgctgggt
atggtggtggacgtggagaatctctttatgtctgttcacaaagaagaggacacagacact
aagcaggtctatttctatctcttcaagctgctgcggaaatgcatcctgcagatgacccgg
ccggtggtggagggctccctgggcagtcccccgtttgagaagcctaatattgagcagggt
gtgctgaactttgtgcagtacaagtttagtcacctggctcctcgggagcggcagacgatg
tttgagctctcaaagatgttcctgctttgccttaactactggaagcttgagacgcctgcc
caatttcggcagcggtctcaggccgaggacgtggctacctacaaggtcaattataccaga
tggctctgctactgccacgtgccccagagctgtgacagcctcccccgctacgagaccact
cacatctttgggcgaagcctcctccgctccatcttcactgtgacccggcggcagttgctg
gagaaattccgggtggagaaggacaagttggtgcctgagaagaggaccctcatccttacc
cacttcccaaaattcctgtccatgctggaggaggagatctatggggcaaactctccaatc
tgggagtccggcttcaccatgccaccctcagaggggacccagctggtgcccaggccggct
acagtcagcgcggcagttgtccccagtgcccccatcttcagccccaccatgggtgggggc
agcaacagctccttaagcctggattccggaggggctgagcccatgccaggtgagaagagg
aagctcccggagaacctgaccctggaggatgccaagcggctccgtgtcatgggcgacatc
cccatggagctggtcaacgaggtcatgctcaccatcactgaccctgccgccatgctgggg
cctgagacgagcctgctgtcggccaacgcagcccgggacgagacggcccgcctggaggag
cgccgcggcatcatcgagttccacgtcatcggcaactcgctgacacccaaggccaaccgg
cgggtgctgctctggcttgtggggctgcagaacgtcttctcccaccagctgccgcgcatg
cccaaggagtacatcgcccgcctcgtctttgacccgaagcacaagactctggccttgatc
aaggatgggcgggtcatcggtgggatctgcttccgcatgtttcccactcagggcttcaca
gagattgtcttctgcgctgtcacctcaaacgagcaggtcaagggctatggcactcacctg
atgaaccacctgaaggagtatcatatcaaacacaacgtcctgtacttcctcacctacgcc
gacgagtatgccattggctacttcaaaaagcagggcttctccaaggacatcaaagtgccc
aagagccgctacctgggctacattaaggactatgagggtgcaacgttgatggagtgtgag
ctgaatccccggatcccctacacggaactgtcccacatcatcaaaaagcagaaggagatc
atcaagaagctgattgaacgcaaacaggcccagatccgaaaggtctaccctgggctcagc
tgcttcaaggagggtgtgaggcagatccctgtggagagtgtccccggcattcgagagacg
ggctggaagccactggggaaggagaaggggaaggagttgaaggatccagaccagctctac
acaaccctcaaaaacttgctggcccagatcaagtcacaccccagtgcctggcccttcatg
gagcctgtgaagaagtcggaggcccctgactactacgaggtcatccgcttccctatcgac
ctgaagaccatgacagagcgactgcgcagccgttactatgtcacccgcaagctcttcgtg
gccgacctgcagcgggtcatcgccaactgccgcgagtacaaccccccggacagcgagtac
tgccgctgcgccagcgccctggagaagttcttctatttcaagctcaaggagggggggctc
attgacaagtag

DBGET integrated database retrieval system