KEGG   Ailuropoda melanoleuca (giant panda): 100468802Help
Entry
100468802         CDS       T01329                                 

Definition
replication protein A 32 kDa subunit-like
Orthology
K10739  
replication factor A2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100468802
   03420 Nucleotide excision repair
    100468802
   03430 Mismatch repair
    100468802
   03440 Homologous recombination
    100468802
   03460 Fanconi anemia pathway
    100468802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 270 aa AA seqDB search
MWFGGSESYSSSSFGGAGGYTQSPGGFGSPTPSQAEKKSRARAQHIVPCTISQLLSATLV
DEMFKIGNVEISQVTVVGIIRHAEKAPTNIVYKLDDMTAAPMDVRQWVDTDDASSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVVNAHMTLSKSNSQPPAGR
APISNPGMGETANFGGNSSMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLQHMTVA
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttggtggatctgaaagctacagcagctcctcctttggcggagcgggcggctac
acgcagtcccccgggggctttggatcgccgacaccttcgcaggctgaaaagaaatcaaga
gcccgagcccagcacattgtaccctgtaccatatctcagctgctttctgccactctggtt
gatgaaatgttcaaaattgggaatgttgagatttcacaggtcactgtcgtgggtataatc
agacatgcagagaaggccccaaccaacatcgtgtacaaactggatgacatgaccgccgcg
cccatggatgtccgtcagtgggttgacacagacgatgccagcagtgaaaacacagtggtt
cctccagagacatatgtgaaagtggctggccatctgagatcttttcagaacaaaaaaagc
cttgtagcctttaagatcatgcctctggaggatatgaatgagttcaccacacatattctg
gaagttgtcaatgcacacatgaccctgagcaaatctaacagccagcccccagcagggaga
gcacctatcagcaatccaggaatgggtgaaacagctaactttggtgggaatagctccatg
ccagcaaatggtctcactgtggcccaaaaccaggtgctgaatttgattaaggcttgtcca
agacctgaaggattaaactttcaggatctcaagaaccagctccaacacatgactgtagcc
tccataaagcaagctgtggattttcttagcaacgagggacacatctattccactgtggac
gatgatcattttaaatccacagacgcagactga

  All links  
No link information was found.   
DBGET integrated database retrieval system