KEGG   Ailuropoda melanoleuca (giant panda): 100468802Help
Entry
100468802         CDS       T01329                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A2, 32kDa
  KO
K10739  
replication factor A2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100468802 (RPA2)
   03420 Nucleotide excision repair
    100468802 (RPA2)
   03430 Mismatch repair
    100468802 (RPA2)
   03440 Homologous recombination
    100468802 (RPA2)
   03460 Fanconi anemia pathway
    100468802 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 362 aa AA seqDB search
KWPQRLPTLSEAECAFSKSTAREDRKKRRVREHXLAEAGSVWTLIGSVLRAKEFVAPEQS
RFSTAAAPGFLGVTRTHQSRLLALSSEGVGTKMWFGGSESYSSSSFGGAGGYTQSPGGFG
SPTPSQAEKKSRARAQHIVPCTISQLLSATLVDEMFKIGNVEISQVTVVGIIRHAEKAPT
NIVYKLDDMTAAPMDVRQWVDTDDASSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMP
LEDMNEFTTHILEVVNAHMTLSKSNSQPPAGRAPISNPGMGETANFGGNSSMPANGLTVA
QNQVLNLIKACPRPEGLNFQDLKNQLQHMTVASIKQAVDFLSNEGHIYSTVDDDHFKSTD
AD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
aaatggccgcagaggcttccgaccctatcggaagcagagtgcgcgttttccaaaagcacg
gcccgagaagacaggaaaaagcgtagagttcgtgagcattgattggctgaagcaggaagc
gtttggacgctgattggctccgtccttcgcgctaaggagtttgtggcaccagagcaaagt
agatttagcactgcggccgcaccggggttcttaggagttacacgaacccaccagtcgcgt
ctcctggccctctcttctgagggagtagggacaaagatgtggtttggtggatctgaaagc
tacagcagctcctcctttggcggagcgggcggctacacgcagtcccccgggggctttgga
tcgccgacaccttcgcaggctgaaaagaaatcaagagcccgagcccagcacattgtaccc
tgtaccatatctcagctgctttctgccactctggttgatgaaatgttcaaaattgggaat
gttgagatttcacaggtcactgtcgtgggtataatcagacatgcagagaaggccccaacc
aacatcgtgtacaaactggatgacatgaccgccgcgcccatggatgtccgtcagtgggtt
gacacagacgatgccagcagtgaaaacacagtggttcctccagagacatatgtgaaagtg
gctggccatctgagatcttttcagaacaaaaaaagccttgtagcctttaagatcatgcct
ctggaggatatgaatgagttcaccacacatattctggaagttgtcaatgcacacatgacc
ctgagcaaatctaacagccagcccccagcagggagagcacctatcagcaatccaggaatg
ggtgaaacagctaactttggtgggaatagctccatgccagcaaatggtctcactgtggcc
caaaaccaggtgctgaatttgattaaggcttgtccaagacctgaaggattaaactttcag
gatctcaagaaccagctccaacacatgactgtagcctccataaagcaagctgtggatttt
cttagcaacgagggacacatctattccactgtggacgatgatcattttaaatccacagac
gcagactga

DBGET integrated database retrieval system