KEGG   Ailuropoda melanoleuca (giant panda): 100468872Help
Entry
100468872         CDS       T01329                                 

Gene name
RARB
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Class
Human Diseases; Cancers; Pathways in cancer [PATH:aml05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:aml05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:aml05223]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 455 aa AA seqDB search
MTTSSHACPVPAVNGHMTHYPAAPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK
IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPSSSGNPAEHSPSTSPSSVENSGVSQSPLVQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagtagccacgcatgcccggtccctgcagtgaatggacacatgactcactac
ccagccgcgccctacccattactctttccaccagtcatcggaggactttccctgcctccc
ctccatggcctgcatggccaccctcctccaagtggatgcagtaccccatcgcctgcaacg
attgaaacacagagtaccagctctgaggaactggtcccaagccctccgtctccacttcct
ccccctcgtgtgtacaaaccctgcttcgtctgccaggacaaatcatcggggtaccactat
ggggtcagcgcctgtgagggctgcaagggctttttccgcagaagtattcagaagaacatg
atttacacttgtcaccgagataagaactgtgttattaataaagtaaccaggaatcgatgc
cagtactgtcggcttcagaagtgctttgaagtgggaatgtccaaagaatctgtcaggaat
gataggaacaagaagaagaaggagccttcgaagcaggaatgcacggaaagctatgagatg
acggcggagctggacgatctcacagagaaaatccgcaaagcccaccaggaaaccttcccc
tccctctgccagctgggtaaatacaccacgaattccagtgctgaccatcgagtccgactg
gacctgggcctctgggacaaattcagtgaactggccaccaagtgcattattaagattgtg
gagtttgctaaacgtctgccaggcttcaccggcttgaccattgcagaccaaatcaccctg
ctgaaggctgcctgcctggacattctgattcttaggatttgcaccaggtacacaccagaa
caagacaccatgactttttcagatggccttaccctaaatcgaactcagatgcacaatgct
ggatttggtcctctgactgaccttgtgttcacctttgccaaccagctcctgcctttggaa
atggatgacacagaaacaggccttctcagtgccatctgcttaatctgtggagaccgccag
gaccttgaggaaccaacaaaagtagataagctacaagaaccactgctggaagcactaaaa
atttatatcagaaagagacgacccagcaagcctcacatgtttccaaagatcttaatgaaa
atcacagatctccgcagcatcagtgctaaaggtgcagaacgtgtaattaccttgaaaatg
gaaattcctggatcaatgccacctctcattcaggaaatgctggagaattctgaaggacat
gaacccttgaccccaagttcaagtgggaacccagcagagcacagtcccagcacctcaccc
agctcagtggaaaacagcggtgtcagtcagtcaccactggtgcaataa

DBGET integrated database retrieval system