KEGG   Ailuropoda melanoleuca (giant panda): 100468902Help
Entry
100468902         CDS       T01329                                 

Definition
histone deacetylase 9-like
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:aml05203]
Human Diseases; Substance dependence; Alcoholism [PATH:aml05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1111 aa AA seqDB search
MSLPPFFPPVSLVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQ
QQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKLQQELLAIKQQQELLEKEQKLEQQRQE
QEVERHRREQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVSRH
PKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDAKDDFPLRKTASEPNLKVRSRLKQ
KVAERRSSPLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNNGPTGNVTENDTS
VLPPTPHAEQIVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPTQLNASNSLKEKQK
CETQTLRQGVPLPGQYAGSIPASSSHPHVALEGKPNSSHQALLQHLLLKEQMRQQKLLVA
GGVPLHPQSPLAAKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLE
KQKQYQQQIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSA
CVDDTLGQVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQPFLEPQHTRALSVHQTQLA
VVGMDGLEKHRLVSRTHSSPAASILPHPAMDCPLQPGSATGIAYDPLMLKHQCICGNSTT
HPEHAGRIQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSLLYGTNPLDGQKLD
PRTLLGDASQKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASRVASGELKNG
FAVVRPPGHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYA
DPSILYISLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDIEYLEAFRT
VVTPVAKEFDPDMVLVSAGFDALEGHAPPLGGYKVTAKCFGHLTKQLMTLADGHVVLALE
GGHDLTAICDASEACVNALLGNELEPLAEDILHQTPNMNAVVSLQKIIEIQSKYWKSVRM
VTVPRGCSLAGTQLQEETETVSALASLTVDVEQPFASEDNRYESNMGESLRSGTSRLIIS
IREPLSRLSFTCLLHFHHLSSSKPQMPQQML
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttccccctttttttcctcctgtttctctagtggatgtgaaatcagaagttccc
gtgggcctagagcccatctcacctttagacctaaggacagacctcaggatgatgatgcct
gtggtggatcctgttgtccgcgagaagcagctgcagcaagaattactcctcatccagcaa
cagcagcaaatccagaagcagctcctgattgcagagtttcagaaacagcatgagaacttg
acacggcagcaccaggctcagctccaggagcacatcaagttgcaacaggaacttctagcc
ataaaacagcaacaagaactcctagaaaaggagcagaaactggagcagcagaggcaagaa
caggaagtagagaggcaccgcagagaacagcagcttcctcctctcagaggcaaagataga
ggacgagaaagggcagtggcaagtacagaagtaaagcagaagcttcaagaattcctgttg
agtaaatcagcaacaaaagacactccaacaaatggaaaaaatcattccgtgagccgccat
cccaagctctggtacacggctgcccaccacacgtcactggatcaaagctctccacccctg
agtggaacgtcgccatcctacaaatacacattaccaggagcacaggatgcaaaggatgat
ttcccccttcgaaaaactgcctctgagcccaacttgaaggtgcggtccaggttaaaacag
aaagtggcagagaggagaagcagccccttactcaggcggaaggatggaaatgttgtcact
tcattcaagaagagaatgtttgaggtgacagaatcctcggtcagcagcagctctccaggg
tctggccccagctcaccaaacaatgggccaactggaaatgttactgaaaatgacacttcc
gttttgccacctactcctcatgctgagcaaattgtgtcccagcaacgcattctaattcat
gaagattccatgaacctgctaagtctttatacctctccttctctgcccaacattaccttg
ggacttccagcagtgccaacgcagctcaacgcttcgaattcactcaaagaaaaacagaag
tgtgagacccagacgctccgacaaggcgttcctctgcccgggcagtacgcgggcagcatc
ccagcatcttcaagccacccccacgttgctttagagggaaagcccaacagcagccaccaa
gcgctcctgcagcatctattattgaaagaacaaatgcgacagcagaagctcctcgtggct
ggtggagtccccttacatcctcagtctccgttggcagcaaaggagagaatttcacctggc
attagaggtacccacaaattaccccgtcacagacccctgaatcgaacgcagtctgcacct
ctgcctcagagcacgttggctcagctggtcattcagcagcaacaccagcaattcttggag
aagcagaagcaataccagcagcagatccacatgaacaaactgctttcgaaatctattgaa
caactgaagcaaccaggcagtcacctcgaggaagcggaggaagagcttcagggggaccag
gcgatgcaggaagacagagcgccctctagtggcaacagcactaggagcgacagcagtgct
tgtgtggatgacacactgggacaagttggggctgtgaaggtcaaggaggaaccagtggac
agtgacgaagatgctcagatccaggaaatggaatctggggagcaggctgcttttatgcaa
cagcccttcttggagccccagcacacacgtgcgctctcagtgcaccaaactcagctggct
gtggttggcatggatggattagagaaacatcgtcttgtctccaggactcattcctcccct
gctgcctccattttacctcatccagcaatggactgccccctccagcctggctctgcaact
ggaattgcctacgaccctctgatgctgaaacaccagtgcatttgtggcaattccaccacc
caccctgagcacgctggacgaatacagagcatctggtcacgactgcaagaaactgggctg
ctaaataaatgtgagcgaattcaaggtcgaaaagctagcctggaggaaatacagcttgtt
cattctgaacatcactcactgttgtatggcaccaaccccctggatggacagaagctggac
cccaggacactcctaggtgatgcctctcaaaagtttttttcttcattaccttgtggtgga
cttggggtggacagtgacaccatttggaatgaactgcactcgtccggtgctgcacgcatg
gctgttggctgtgtcatcgagctggcttccagagtggcctcaggagagctgaagaatggg
tttgctgttgtaaggcccccaggccatcatgctgaagaatccacagccatggggttctgc
ttttttaattcagttgcaattaccgccaaatacttgagagaccaactaaatataagcaag
atattgattgtagatctggatgttcaccatggaaatggtacacagcaggccttttatgct
gaccccagcatcctgtatatttcactccatcgctatgatgaagggaactttttccctggc
agtggagccccaaatgaggttggaacaggccttggagaaggatacaatataaatattgcc
tggacaggtggccttgatcccccgatgggagatatagagtaccttgaagcattcaggact
gtagtgacgcctgtggccaaagagtttgatccagacatggtcctagtctccgctggattt
gatgcattagaaggccatgcccctcctctgggggggtacaaagtgacagcaaaatgcttt
ggtcatttgacgaagcagttgatgacattggctgatggacacgtggtgttggctctagaa
ggaggacatgatctcacagccatctgtgatgcatcagaagcctgtgtaaatgcccttcta
ggaaacgagctggagccacttgccgaagatattctccaccaaaccccgaatatgaatgct
gttgtttctttacagaagatcattgaaattcaaagcaagtactggaagtcagtaaggatg
gtgactgtgccaaggggttgttctttggctgggactcagctgcaagaggagaccgagact
gtttctgccctggcctccctgacggtagatgtagaacagccctttgcttctgaagataac
aggtatgaatccaacatgggggagtcattaaggtcaggaacatccaggctcatcattagc
attcgtgaacctctctccaggctttccttcacctgtctcctccacttccaccacctgtct
tcttcaaagccacagatgccacagcaaatgctgtag

DBGET integrated database retrieval system