KEGG   Ailuropoda melanoleuca (giant panda): 100469005Help
Entry
100469005         CDS       T01329                                 

Definition
d-beta-hydroxybutyrate dehydrogenase, mitochondrial-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:aml00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:aml00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 343 aa AA seqDB search
MLTARLFRPLSQLPGRTLSCYNRENGTRPMLLFYSASLVPISRRAYSDEVKPVGSKAVLV
TGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGDTGVKELDSLKSDRLRTVQLNVCKSEEV
EKVVETVRSSLEDPEKGLWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRMTKSFL
PLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMHSRGVKVSVVEPGN
FIAATSLYSPERIQAIADKMWDELPEVVRKDYGRKYFDEKIAKMETYCNSGSTDTSPVIN
AVTHALTSASPYTRYHPMDYYWWLRMQIMTHLPGAVSDRIYIH
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgcccgcctcttcagacccctgtcacagctcccagggagaaccttgagttgc
tacaatagagaaaatggaacaaggcccatgctgctgttttactctgcttctttggtccct
atcagccgtcgtgcttattctgatgaggtgaagccggttggcagcaaagctgtcctggtc
acaggctgtgactcgggatttgggttctccttggccaagcatctgcattcaaaaggcttc
cttgtgtttgctggctgcttgatgaaggacaaaggagatactggcgtcaaggagctggac
agcttgaagagtgatcgattaagaactgtccagctgaacgtctgcaaaagtgaggaggtg
gagaaagtggtggagaccgtccgctcgagcctggaggaccctgagaaaggcctgtggggc
ctagttaacaatgcgggcatctcaactttcggagaggtggagttcaccagcatggagacc
tacaaggaagtggcggaagtgaacctctggggcacggtgcggatgacgaaatcctttctc
cccctcatccgaagggccaaaggccgcgtcgtcaacatcagcagcatgctaggccgcatg
gccaacccggcccgctccccctactgcatcaccaagttcggggtggaggccttctctgac
tgcctgcgctacgagatgcactcgcggggcgtgaaggtcagcgtggtggaacctggcaac
ttcatcgctgccaccagcctctatagccctgagcgtatccaggccatcgccgataagatg
tgggacgagctgcctgaggtggtgcgcaaggactatggcaggaagtactttgacgagaag
atcgccaagatggagacctactgtaacagtggctccacagacacatcccccgtcatcaat
gcggtcacccacgctctgacgtccgccagcccctacactcgctaccaccccatggactac
tactggtggcttcgaatgcagatcatgacccacttgcccggagcggtgtccgacaggatc
tatatacactga

DBGET integrated database retrieval system