KEGG   Ailuropoda melanoleuca (giant panda): 100469111Help
Entry
100469111         CDS       T01329                                 

Gene name
MAP2K6
Definition
mitogen-activated protein kinase kinase 6
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Influenza A
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100469111 (MAP2K6)
   04010 MAPK signaling pathway
    100469111 (MAP2K6)
   04668 TNF signaling pathway
    100469111 (MAP2K6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100469111 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    100469111 (MAP2K6)
  Endocrine system
   04912 GnRH signaling pathway
    100469111 (MAP2K6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100469111 (MAP2K6)
  Development
   04380 Osteoclast differentiation
    100469111 (MAP2K6)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100469111 (MAP2K6)
  Infectious diseases
   05164 Influenza A
    100469111 (MAP2K6)
   05169 Epstein-Barr virus infection
    100469111 (MAP2K6)
   05145 Toxoplasmosis
    100469111 (MAP2K6)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100469111 (MAP2K6)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100469111 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 334 aa AA seqDB search
MSLPIGRKRNPGLKIPKEAFEQPQPSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSEEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVASFVKLILGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccccataggcaggaagcgaaaccctggccttaagattccaaaggaagcattt
gaacaacctcagcccagttccacgccacctcgagacttagactctaaagcttgcatttct
attggaaatcagaactttgaggtgaaggccgatgacctggagcccataatggaactgggg
cgaggtgcgtacggggtggtggagaagatgcgacacgtgcccagcgggcagatcatggcg
gtgaagcggatccgggccacagtaaatagccaggagcagaaaaggctactgatggatttg
gatatttccatgaggacagtggactgtcctttcaccgtcaccttttatggtgccctcttc
cgggagggtgacgtttggatctgtatggagctcatggatacgtcgctagataaattctac
aaacaagtgattgataaaggccaaacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcgttagaacacttacacagtaagctctctgtcattcatcgagacgtc
aagccttccaacgtgctgatcaacactctgggccaagtgaagatgtgcgattttggaatc
agtggctaccttgtggactctgtggctaaaactattgatgcaggatgcaaaccgtacatg
gctcctgaaagaataaacccagagctcaatcagaagggctacagtgtgaagtctgacatt
tggagtctgggcatcacaatgattgagttggcaatccttcggtttccctacgactcttgg
ggaactcccttccagcagctcaaacaggtggtggaggaaccctcgccacaactcccagcg
gacaaattctccgaagagtttgttgactttacctcacagtgcttgaagaagaattccaaa
gaacggccaacatatccagaacttatgcaacatccatttttcaccctacacgaatccaaa
gcaacagacgtggcatcttttgtaaaactgattcttggagactaa

DBGET integrated database retrieval system