KEGG   Ailuropoda melanoleuca (giant panda): 100469111Help
Entry
100469111         CDS       T01329                                 

Gene name
MAP2K6
Definition
(RefSeq) mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04015  Rap1 signaling pathway
aml04218  Cellular senescence
aml04380  Osteoclast differentiation
aml04620  Toll-like receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04750  Inflammatory mediator regulation of TRP channels
aml04912  GnRH signaling pathway
aml05014  Amyotrophic lateral sclerosis (ALS)
aml05145  Toxoplasmosis
aml05164  Influenza A
aml05167  Kaposi's sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05418  Fluid shear stress and atherosclerosis
Module
aml_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100469111 (MAP2K6)
   04010 MAPK signaling pathway
    100469111 (MAP2K6)
   04668 TNF signaling pathway
    100469111 (MAP2K6)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100469111 (MAP2K6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100469111 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    100469111 (MAP2K6)
  Endocrine system
   04912 GnRH signaling pathway
    100469111 (MAP2K6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100469111 (MAP2K6)
  Development
   04380 Osteoclast differentiation
    100469111 (MAP2K6)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100469111 (MAP2K6)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100469111 (MAP2K6)
  Infectious diseases
   05164 Influenza A
    100469111 (MAP2K6)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100469111 (MAP2K6)
   05169 Epstein-Barr virus infection
    100469111 (MAP2K6)
   05145 Toxoplasmosis
    100469111 (MAP2K6)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100469111 (MAP2K6)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: STE group
  STE7 family
   100469111 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase Choline_kinase DUF4344 APH
Motif
Other DBs
NCBI-GeneID: 100469111
NCBI-ProteinID: XP_002924264
Ensembl: ENSAMEG00000007357
Position
Un
AA seq 334 aa AA seqDB search
MSQSKGRKRNPGLKIPKEAFEQPQPSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSEEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVASFVKLILGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaggaagcgaaaccctggccttaagattccaaaggaagcattt
gaacaacctcagcccagttccacgccacctcgagacttagactctaaagcttgcatttct
attggaaatcagaactttgaggtgaaggccgatgacctggagcccataatggaactgggg
cgaggtgcgtacggggtggtggagaagatgcgacacgtgcccagcgggcagatcatggcg
gtgaagcggatccgggccacagtaaatagccaggagcagaaaaggctactgatggatttg
gatatttccatgaggacagtggactgtcctttcaccgtcaccttttatggtgccctcttc
cgggagggtgacgtttggatctgtatggagctcatggatacgtcgctagataaattctac
aaacaagtgattgataaaggccaaacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcgttagaacacttacacagtaagctctctgtcattcatcgagacgtc
aagccttccaacgtgctgatcaacactctgggccaagtgaagatgtgcgattttggaatc
agtggctaccttgtggactctgtggctaaaactattgatgcaggatgcaaaccgtacatg
gctcctgaaagaataaacccagagctcaatcagaagggctacagtgtgaagtctgacatt
tggagtctgggcatcacaatgattgagttggcaatccttcggtttccctacgactcttgg
ggaactcccttccagcagctcaaacaggtggtggaggaaccctcgccacaactcccagcg
gacaaattctccgaagagtttgttgactttacctcacagtgcttgaagaagaattccaaa
gaacggccaacatatccagaacttatgcaacatccatttttcaccctacacgaatccaaa
gcaacagacgtggcatcttttgtaaaactgattcttggagactaa

DBGET integrated database retrieval system