KEGG   Ailuropoda melanoleuca (giant panda): 100469112Help
Entry
100469112         CDS       T01329                                 

Definition
general transcription factor 3C polypeptide 4-like
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100469112
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     100469112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 823 aa AA seqDB search
MSSADKARVGPAADGPVPXXXXXXXXXGGEAGGKEPATDAAPGPSAAFRFLVSRREPAVK
LQYAVSGLXXXXXXXXTRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLK
VGSKAEVAECKEKFATSKDPTVSQTFMLDRVFNPEGKALPPMRGFKYTSWSPMGCDANGR
CLLAALTMDNRLTIQANLNRLQWVQLVDLTEIYGERLYETSYRLSKSEAPEGNLGDFAEF
QRRHSMQTPVRMEWSGICTTQQVTHNNECRDVGSVLLAVLLENGNIAVWQFQLPFVGKES
ISSCNTIESGISSPSVLFWWEYEHSNRKMSGLIVGSAFGPVKILPVNLKAVKGYFTLRQP
VVLWKEMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVT
GLHSLPIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHG
IAVSPCGAYLAVITTEGMVNGLHPVNKNHQVQFVTLKTFEEAAAQLLESSVQNLFKQVDL
IDLVRWKILKDKHIPQFLQEALEKKIESSGATYFWRFKLFLLRILYQSMQKTPSEALWKP
THEDSKILLVDSPGMGNAEEEQQEEGTSSKQANRQGLQERSREGDPEDPTDDSLTQAGDA
GGREPMEEKLLELQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSD
EEYDDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQS
CQSLIYRRCLLHDSIARHPAPDDPDWIKRLLQSPCPFCDSPVF
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgagctcggccgacaaggcccgggtggggcccgcggccgacgggcctgtgccnnnnnnn
nnnnnnnnnnnnnnnnnnnggggcggcgaggcgggcgggaaggagccagcaacggacgcg
gcccccgggcccagtgcagcgttccgcttcctggtatctcggcgggagccggccgtgaag
ctgcagtatgcagtgagcggcttgnnnnnnnnnnnnnnnnnnnnnnccacccgcgtgtcc
gtgtccacggcccgcagcatcgctgtgctggagctcatctgcgacgtgcacaacccgggc
caggacctggttatccaccgcacctcggtgcccgctcctctcaacagctgcctcctcaaa
gttggctccaaagcagaagttgctgagtgtaaggagaagtttgccacctccaaagacccc
acagtcagtcagactttcatgttggatagggtgttcaaccctgaggggaaggcgttgcca
ccaatgagaggattcaagtatactagctggtcccccatgggttgcgatgcaaatggcagg
tgcctcttggcggcgctgaccatggacaatcgcctgaccatccaggccaacctcaacaga
ctgcagtgggtccagctggtggatctgactgagatttatggagaacgtctttacgagacc
agttacaggctctctaaaagtgaggctccagaggggaatctcggggacttcgcggagttt
cagaggaggcacagcatgcagacgccagtccggatggagtggtcgggcatctgtaccact
cagcaggttacgcacaacaacgagtgccgggacgtgggcagcgtgctcctggcggtcctc
ttggagaacgggaacattgctgtgtggcagttccagctgcccttcgtggggaaggagtcc
atctcttcgtgcaacaccattgaatcaggaatcagctctcctagtgttttgttttggtgg
gaatatgagcacagtaatcgaaaaatgagcggccttattgtggggagtgcttttggaccc
gtgaaaattcttcctgtcaatctcaaagcagttaaaggctatttcactttaaggcagccc
gttgtcttgtggaaagaaatggaccagttgccggtgcacagcattaaatgtgttccgctc
tatcacccttaccagaagtgtagttgtagcttagtggtggctgcaagaggatcctatgtg
ttttggtgtctccttctgatctccaaagcgggtctcaatgtccacaattcccacgtcaca
ggccttcactcactgccgattgtctccatgactgcagacaagcagaatggaacagtatat
acctgttccagcgatgggaaggtgaggcagctgattcccattttcaccgatgtcgcatta
aagtttgagcaccagttaattaaactctccgatgtgtttggctcagtgaggacacacggg
atagcagtgagcccctgcggcgcgtatctggccgtcatcaccactgagggcatggtcaat
ggcctccatcccgtgaacaaaaaccaccaggtccagtttgtcactctcaaaacctttgaa
gaggcagcggctcagctcctggaatcgtcagttcagaatctcttcaagcaggtagactta
atagatcttgtacgctggaagattttaaaagataaacacatccctcagtttttacaggaa
gctttggaaaaaaagattgaaagcagcggggccacctatttttggcgtttcaagctgttc
ctcctgcggattttgtatcagtcaatgcagaaaaccccttcggaagcattatggaaaccc
acccatgaggactccaaaatcttattagttgactcccctgggatgggcaatgctgaggaa
gaacagcaagaggaaggcacgtcttccaaacaggcgaataggcagggccttcaggagagg
agcagagagggcgacccggaggaccccaccgacgattcactgacccaggctggagatgcc
gggggccgtgagccaatggaagagaagcttctggagctccaagggaaaatcgaagctgtg
gaaatgcacttgaccagggagcacatgaagcgagtcttaggggaagtgtacttgcacacc
tggatcacagaaaacactagcatccccaccaggggactctgtaacttcctgatgtctgat
gaggagtacgatgaccgaacagcacgggtgctgattggacacatctcaaagaagatgaac
aaacagactttccctgagcactgtagtttgtgtaaagagatcttgccgttcacagatcgc
aaacaggcagtctgctccaatggccacatttggctccggtgctttttaacctaccagtcc
tgccagagtttgatatacagaaggtgtttgctccacgacagcatcgcccgccatccggct
cccgacgatcctgactggattaagaggttactgcaaagcccctgccctttctgcgattct
cctgtcttctga

DBGET integrated database retrieval system