KEGG   Ailuropoda melanoleuca (giant panda): 100469132Help
Entry
100469132         CDS       T01329                                 

Gene name
ACSS1
Definition
(RefSeq) acyl-CoA synthetase short-chain family member 1
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100469132 (ACSS1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100469132 (ACSS1)
   00620 Pyruvate metabolism
    100469132 (ACSS1)
   00640 Propanoate metabolism
    100469132 (ACSS1)
Enzymes [BR:aml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100469132 (ACSS1)
Lipid biosynthesis proteins [BR:aml01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100469132 (ACSS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 669 aa AA seqDB search
MVKQILRRERECERAPRARCTFLGLSASGRLARWRRGAWAAAWGRARVPAAFWGPLARDT
LVWDTPYHTVWDCDFSSGKIGWFLGGQLNVSVNCLDQHVQKSPESVALIWERDEPGTEVR
ITYRELLETTCRLANTLKRHGIRRGDRVAIYMPVSPLAVAAMLACARIGAVHTVVFAGFS
AESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKQCPTVQHVLVAHRTDNKVHM
GHRDIPLEQEMAKEDPVCAPESMGSEDMLFLLYTSGSTGTPKGLVHTQAGYLLYAALTHR
LVFDYRPGDVFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPDAGRYWETVQRLK
INQFYGAPTAVRLLLKYGDSWVKKYDRSSLRTLGSVGEPINLEAWEWLHKVVGDSRCTLV
DTWWQTETGGICIAPRPSEEGAEILPAMAMRPFFGIVPVLMDEKGKVVEGGNVSGALCLS
QAWPGMARTIYGDHQRFVEAYFKPYPGHYFTGDGAYRTEGGYYQITGRMDDVINISGHRL
GTAEIEDAMANHPAVPETAVIGYPHDIKGEAAFAFIVLKDNTGDTDVVVKELRSAVATKI
AKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITGRTQDLGDTTTLEDPNVITEILSAYQK
HKDKQAASQ
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcagatactaagacgtgagcgggagtgcgagcgggcaccccgagctcgctgc
accttcttggggctcagtgcctccgggcgtctggcgagatggcggcgcggggcctgggcc
gcagcgtggggccgggcccgggtgccggccgctttctgggggccgctggcgcgggacacg
cttgtgtgggacaccccctaccacaccgtctgggactgtgacttcagcagcggcaagatc
ggctggtttctgggaggccagttaaacgtgtctgtcaactgcttggatcagcacgttcag
aagtctccagagagcgtcgctttgatctgggagcgggatgagcccggaactgaagtgagg
atcacatacagggaactgctggagaccacctgccgcctggccaacacgctgaagagacat
ggcatccgtcgaggggaccgtgtggccatctacatgcctgtttccccactggctgtggcc
gcaatgctggcctgtgccaggattggagccgtccacactgttgtctttgctggcttcagt
gcggagtctttggctgggaggatcaatgatgccaagtgcaaggtggtcatcaccttcaac
caaggactccggggagggcgcgtggtggagctgaagaagattgtggatgaagctgtgaag
cagtgcccgaccgtccagcacgtcctggtggctcacaggacggacaacaaggtccacatg
ggacatcgggacatcccccttgagcaggaaatggccaaggaggaccctgtgtgcgctccg
gagagcatgggcagtgaggacatgctcttcttgctgtacacttcagggagcactgggacc
cccaagggactcgtccacacccaggcgggctacctgctatatgccgccctgacacacagg
cttgtgtttgactaccggccaggtgacgtctttggctgtgtggccgacattggctggatc
acaggacacagctatgtggtgtacggacccctgtgcaatggagcaaccagcgtccttttt
gagagcaccccggtttaccctgatgctggtcgatactgggagacagtgcagaggttaaag
atcaatcagttctatggggccccgacggctgtccggctgttgttgaaatacggcgactcc
tgggtgaagaagtatgaccgctcttccctgaggaccctgggatcagtgggagaaccgatc
aacttggaggcttgggagtggctccacaaggtggtgggggacagcagatgcacgctggtg
gacacatggtggcagacagaaacggggggcatctgcatcgcgccacggccctcagaggaa
ggggcagagatcctccctgccatggcaatgaggcccttttttggcattgtcccggtgctc
atggatgagaagggaaaggtcgtggagggcggtaacgtctctggggctctgtgcctgtcc
caggcctggccgggcatggccaggaccatctacggagaccaccagagattcgtggaggcc
tacttcaagccttacccaggccactactttactggcgatggggcataccggacagagggt
ggctactaccagatcacaggccggatggacgacgtcatcaacatcagcggccacaggctg
gggacggcagagatcgaggatgcgatggctaaccacccggcagtgccagagactgcggtc
attggctatccccatgacatcaaaggagaagctgcatttgccttcattgtgttgaaggac
aacacaggtgacacagatgtggtggtgaaggagctcagatcagcagtggccaccaagatt
gccaagtacgctgtgcctgacgagatactggtagtgaagcgtcttccaaaaactcggtct
ggaaaagtcatgcggaggctcctgaggaagataatcacaggcagaactcaggatctgggg
gacaccaccaccctggaggaccccaatgtcatcacagaaatcctgagtgcctaccagaag
cacaaagacaagcaagctgcctctcagtga

DBGET integrated database retrieval system