KEGG   Ailuropoda melanoleuca (giant panda): 100469296Help
Entry
100469296         CDS       T01329                                 

Gene name
NLK
Definition
nemo-like kinase
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100469296 (NLK)
   04310 Wnt signaling pathway
    100469296 (NLK)
   04068 FoxO signaling pathway
    100469296 (NLK)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    100469296 (NLK)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100469296 (NLK)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100469296 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 527 aa AA seqDB search
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaagagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttccacacctccctcct
cctcaccttcaccaccaccaccaccctcaacaccatcttcatccggggtcggctgccgct
gtacaccctgttcagcagcatacctcttcggcagctgcggcagccgcagcagcggccgca
gctgcagccatgttaaaccctgggcaacaacagccatatttcccatcacccgcaccgggt
caggctcctggaccagctgcagcagccccagctcaggtacaggctgccgcagctgctaca
gttaaggcgcaccaccatcaacactcgcatcatccacaacagcagctggatattgagccg
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcactcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agggtcttccgggaattgaagatgttgtgtttttttaaacatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatacgttgtcacagaa
ttgatgcagagtgacctacataaaattatcgtctctcctcaaccactcagctcagatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcagctggcatt
ttacatcgagacattaagccagggaatctccttgtgaacagcaactgtgttctaaagatt
tgtgattttggattggccagagtggaggaattagatgaatcccgtcatatgactcaggaa
gttgttactcagtattatcgggctccggaaatcctgatgggcagtcgtcattacagcaat
gctattgacatctggtctgtcggatgtatctttgcagaactactaggacgaagaatactg
tttcaggcacaaagtcccattcagcagctggatttgatcacggatcttttgggcacacca
tcgctggaagcaatgaggacggcttgtgaaggcgctaaggcgcacatactcaggggccct
cataaacagccatctcttcctgtactttataccctgtctagccaggctacacatgaagct
gttcatctcctttgcaggatgttggtctttgatccatccaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcgactacgatatcacacgtgtatgtgtaaa
tgttgcttttccacctctactggaagagtttataccagtgactttgagcccatcaccaat
cccaaatttgatgacacttttgagaagaacctcagttctgttcgacaggttaaagaaatt
attcaccagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaacccg
cagtctgctgcttttaagagctttattagttccactgttgcccagccgtctgagatgccc
ccatctcctctggtgtgggagtga

DBGET integrated database retrieval system