KEGG   Ailuropoda melanoleuca (giant panda): 100469440Help
Entry
100469440         CDS       T01329                                 

Definition
ecto-ADP-ribosyltransferase 3-like
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100469440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 389 aa AA seqDB search
MKTGHFDMVTMLLAAMILMDIFQVKGEMLDMADNAFDDEYQKCTGRMEVKYVPQLLKEEK
ASHQLLKDVWENAEAKWEARKTRIVVPMSFKDNHGIALMAYVSEAQEQTPFYHMFSEAVK
TAGLSRKDYVYDFQFKAFHFYLTTALQLLRRPCEDSYKTVVYSISQDVSFTFGGLNQARF
GHFVLAYSAKPQAANDQHILLTIHTCFGVAIEHFFDKESERIILIPLNEIFNVSQDGASN
NLILQSTNKTCSHYECAFLGGLKTENCVENMEHHLPIYIYNPGEKDQNLEDPGMKSQEPT
VLPGMTSHEPTQIPGMKIPEAFSLPGIKVVQLDEKPEDKSQEDIGNPAPGPVPGPKTHPS
ASSGKMFLPPLETFIILISASAGNLFVAL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaggacattttgatatggtcaccatgctgctggcagctatgattctgatggac
attttccaggtgaagggtgaaatgttagacatggcagataatgcatttgatgatgaatac
caaaaatgcacgggcaggatggaagtcaaatatgttccccaattgctcaaggaggagaaa
gcaagccatcagctcttgaaggatgtgtgggaaaatgcagaagccaaatgggaagcccgg
aagactcgcatcgttgtccctatgagttttaaagataaccatggaatagcactgatggcg
tacgtttctgaagctcaagagcagactcccttttaccatatgttcagtgaagctgtgaag
acagccggcctatctcgaaaagattatgtctatgacttccagttcaaagcttttcatttt
tatctgacaacagccctgcagttgctgagaagaccttgtgaggacagttacaaaactgtg
gtgtatagtataagccaggatgtctcatttacatttggagggctaaaccaagccagattt
ggccatttcgtcttggcgtattcagccaaacctcaagctgctaatgaccaacacattttg
ttaaccatccacacgtgctttggagtcgccattgaacatttttttgataaagaaagtgaa
agaattattttaatacctctgaatgagatttttaatgtgtcacaggatggggccagcaat
aaccttatccttcaaagcacaaacaagacctgcagccattatgagtgtgcgtttctaggt
ggactaaaaactgaaaattgtgttgagaacatggaacatcatctacccatctatatctac
aaccctggtgagaaagaccagaaccttgaagaccctggaatgaaaagccaggaacccact
gtcttacctggtatgacaagccatgaacccacccaaatacctggaatgaaaattccagaa
gctttttcactaccaggaataaaagtggtacaactggatgaaaaacctgaagacaaaagt
caagaagatattggcaatcctgctccaggtccagttccaggtcccaaaacccatccatct
gcatcctctggaaaaatgttccttccaccattggagactttcatcattttaatcagtgct
tctgctggaaatctctttgttgctttgtag

DBGET integrated database retrieval system